[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87106.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  11/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:105 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   8->97 1yv2A PDBj 3e-04 25.6 %
:BLT:SWISS 8->97 POLG_HCVBB 7e-04 26.7 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87106.1 GT:GENE AAK87106.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 1306585..1306902 GB:FROM 1306585 GB:TO 1306902 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK87106.1 GB:DB_XREF GI:15156368 LENGTH 105 SQ:AASEQ MKWFLILWAGPVALLGSWYWLSYYDMSFGFYMLTRQTHDLVFEIYGNILGIPPENLPPMVARAIAVDSLIVFAILAYRKRKQIAAWWQGRQSAARVSAESLSSAP GT:EXON 1|1-105:0| BL:SWS:NREP 1 BL:SWS:REP 8->97|POLG_HCVBB|7e-04|26.7|90/3037| TM:NTM 2 TM:REGION 3->20| TM:REGION 56->77| BL:PDB:NREP 1 BL:PDB:REP 8->97|1yv2A|3e-04|25.6|90/548| OP:NHOMO 11 OP:NHOMOORG 11 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-111111111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 90 STR:RPRED 85.7 SQ:SECSTR #######HHHHHHHTTTcHHHHHTHHHHHHHHHHHHTccEEEEETTEEEEEcGGGHHHHHHHHHcGGGGTcccccHHHHHHHHHHHHHHHHHHHHHH######## DISOP:02AL 95-98, 100-105| PSIPRED ccEEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHcccccccccc //