[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87119.2
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  66/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:145 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   40->131 PF09923 * DUF2155 1e-25 57.3 %
:HMM:PFM   40->131 PF09923 * DUF2155 6e-34 47.2 89/90  
:BLT:SWISS 45->131 Y359_RICPR 2e-06 25.3 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87119.2 GT:GENE AAK87119.2 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 1315775..1316212 GB:FROM 1315775 GB:TO 1316212 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK87119.2 GB:DB_XREF GI:159140002 LENGTH 145 SQ:AASEQ MRKITRDRSLRALTVSLFAAVSAVLIVSPVAAARLENRVAVFSGIDKITGRITSFDVYIDETVQFGALQVTPKVCYSRDQTETQKIDAFVEVDEITLDRKIRRIFTGWMFADSPGLNAVEHPIYDVWLTGCKQDSEVPAPSTASK GT:EXON 1|1-145:0| BL:SWS:NREP 1 BL:SWS:REP 45->131|Y359_RICPR|2e-06|25.3|87/155| TM:NTM 1 TM:REGION 11->33| RP:PFM:NREP 1 RP:PFM:REP 40->131|PF09923|1e-25|57.3|89/89|DUF2155| HM:PFM:NREP 1 HM:PFM:REP 40->131|PF09923|6e-34|47.2|89/90|DUF2155| OP:NHOMO 66 OP:NHOMOORG 66 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111-11111111111111111111111111111-111111111111111111111111-1111-1------1--------------1-1-----------------------------11----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6,136-146| PSIPRED cccccccccHHHHHHHHHHHHHHHEEEcccccccccccEEEEEEEEccccEEEEEEEccccEEEEEEEEEEEEEEEcccccccccccEEEEEEEEEccccccccccEEEEEcccccccccccEEEEEEEEcccccccccHHHHcc //