[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87124.2
DDBJ      :             outer membrane protein
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  208/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.47.1
:255 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   77->247 3gykB PDBj 1e-23 37.2 %
:RPS:PDB   86->240 1a2lA PDBj 2e-17 12.3 %
:RPS:SCOP  88->243 1z6mA1  c.47.1.13 * 5e-16 24.7 %
:HMM:SCOP  72->245 1z6mA1 c.47.1.13 * 2.7e-38 35.8 %
:RPS:PFM   101->243 PF01323 * DSBA 1e-07 29.6 %
:HMM:PFM   98->243 PF01323 * DSBA 1.6e-24 28.8 146/193  
:BLT:SWISS 83->233 NHAA2_STRCO 2e-07 21.9 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87124.2 GT:GENE AAK87124.2 GT:PRODUCT outer membrane protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(1319283..1320050) GB:FROM 1319283 GB:TO 1320050 GB:DIRECTION - GB:PRODUCT outer membrane protein GB:PROTEIN_ID AAK87124.2 GB:DB_XREF GI:159140004 LENGTH 255 SQ:AASEQ MAHFLRSTLLASVTALSTVFACLPAHALDEQQKKEMGEFIKQYLIENPEIMLEVQDALERKQYASRNAKAAEAVADNKKAIFESKYDLALGNPDGDVTLVEFFDYNCGYCKRAMGDMDNILKGDKKVRVVLKEFPILGPESVAAHRVSNAVKLLAPAKYAEFQRTLLGGRGRANEDSAMEVATSLGLKEADIRKSMADNPNDAQVQETYKLATSLGITGTPSYIVGDEAVFGAVGADPLKEKIANMRSCGKATCS GT:EXON 1|1-255:0| BL:SWS:NREP 1 BL:SWS:REP 83->233|NHAA2_STRCO|2e-07|21.9|151/629| BL:PDB:NREP 1 BL:PDB:REP 77->247|3gykB|1e-23|37.2|164/168| RP:PDB:NREP 1 RP:PDB:REP 86->240|1a2lA|2e-17|12.3|155/186| RP:PFM:NREP 1 RP:PFM:REP 101->243|PF01323|1e-07|29.6|142/178|DSBA| HM:PFM:NREP 1 HM:PFM:REP 98->243|PF01323|1.6e-24|28.8|146/193|DSBA| GO:PFM:NREP 2 GO:PFM GO:0015035|"GO:protein disulfide oxidoreductase activity"|PF01323|IPR001853| GO:PFM GO:0030288|"GO:outer membrane-bounded periplasmic space"|PF01323|IPR001853| RP:SCP:NREP 1 RP:SCP:REP 88->243|1z6mA1|5e-16|24.7|146/172|c.47.1.13| HM:SCP:REP 72->245|1z6mA1|2.7e-38|35.8|165/0|c.47.1.13|1/1|Thioredoxin-like| OP:NHOMO 286 OP:NHOMOORG 211 OP:PATTERN -----------------------1------------------------------------------12 --1--1---------------------------------------------------------------11------------------------------------------------------------------------------1-------------1------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111-1122332222333222222222213-25327242211-11121121111122111313211111211111111-111111111111111111111111111-11111111-11111-------------------------------------------------------------------------------1--1111---------1111-------------------------------221----1--1--111--2---11-11111-------------1----1--------1----------------------223----121211121212221121-------1-1-------1-------111111111--1----------------------------------------------111111111--111-----121--------------------111111------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 239 STR:RPRED 93.7 SQ:SECSTR #########cccccHHHHHHHHHHHHHHHTcccccccHHHHHHHTTccccHHHHHHHHHHHHHHHHHHHcccccccTTTEEEEEcEEEcccccTTcccEEEEEcTTcHHHHHHHTTccHHHHHHHHccTTccEEEEEcccccTHHHHHHHHHHHHHHHHHHHHHHHHTccccccHHHHHHHHHHHTccHHHHHHHHTcHHHHHHHHHHHHHHHHTTcccccEEEETTEEccTTcccccHHHHHHHHHH####### DISOP:02AL 1-2,25-34,59-74,253-256| PSIPRED cHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHccccccccccccccccEEEEEEcccccHHHHHHHHHHHHHHHHcccEEEEEEEcccccccHHHHHHHHHHHHHHcHHHHHHHHHHHHHccccccHHHHHHHHHHccccHHHHHHHHccHHHHHHHHHHHHHHHHcccccccEEEEccEEEcccccHHHHHHHHHHHHHHHHHHcc //