[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87128.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  80/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.58.4
:121 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   1->94 2bbeA PDBj 2e-14 13.8 %
:RPS:SCOP  1->96 1iujA  d.58.4.5 * 1e-13 13.5 %
:HMM:SCOP  1->103 1xbwA_ d.58.4.5 * 2.2e-23 33.3 %
:HMM:PFM   1->76 PF03992 * ABM 6.2e-16 22.4 76/78  
:HMM:PFM   71->102 PF07836 * DmpG_comm 0.00057 28.1 32/66  
:BLT:SWISS 34->95 YQJZ_BACSU 2e-04 30.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87128.1 GT:GENE AAK87128.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 1322490..1322855 GB:FROM 1322490 GB:TO 1322855 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK87128.1 GB:DB_XREF GI:15156392 LENGTH 121 SQ:AASEQ MIAVIFEVWPAEGEKQHYLDIAAGLRAELETIDGFLSIERFQSISNPEKMLSLSFFRDEQAVRAWRNTLPHRTAQALGRSGVFSDYRLRIAHVIRDYGLLEREEAPADSRDAHPVEGSSLG GT:EXON 1|1-121:0| BL:SWS:NREP 1 BL:SWS:REP 34->95|YQJZ_BACSU|2e-04|30.0|60/114| RP:PDB:NREP 1 RP:PDB:REP 1->94|2bbeA|2e-14|13.8|94/103| HM:PFM:NREP 2 HM:PFM:REP 1->76|PF03992|6.2e-16|22.4|76/78|ABM| HM:PFM:REP 71->102|PF07836|0.00057|28.1|32/66|DmpG_comm| RP:SCP:NREP 1 RP:SCP:REP 1->96|1iujA|1e-13|13.5|96/102|d.58.4.5| HM:SCP:REP 1->103|1xbwA_|2.2e-23|33.3|102/0|d.58.4.5|1/1|Dimeric alpha+beta barrel| OP:NHOMO 87 OP:NHOMOORG 80 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111-1-----------------------1----------------------1-------211--------11111111111----------1--111-111111---1---1-------11--------1------1------------------------------------111--------------12---------1211--11---1111-2---11-----1------------------1-----1------------------------------------------------------------21221--1111-1--11---------------1-------------------------1---------11-----1-----------1----1-------1----------------------------1----------------------------------1------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 99 STR:RPRED 81.8 SQ:SECSTR cEEEEEEEEEcTTcHHHHHHHHHTTHHHHHTcTTEEEEEEEEccccTTEEEEEEEEccHHHHHHHHTcHHHHHHHHHTHHHHEEEEEEEEEccEccccc###################### DISOP:02AL 100-121| PSIPRED cEEEEEEEEEccccccHHHHHHHHHHHHHHHccccccHHHHcccccccEEEEEEEcccHHHHHHHHHcHHHHHHHHHHHHHHHcccEEEEEEEEEEccccccccccccccccccccccccc //