[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87141.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  12/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.24.10
:122 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  24->124 1wn0A1 a.24.10.2 * 1.9e-13 29.0 %
:HMM:PFM   45->101 PF01627 * Hpt 1.1e-10 29.8 57/90  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87141.1 GT:GENE AAK87141.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 1344809..1345177 GB:FROM 1344809 GB:TO 1345177 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAK87141.1 GB:DB_XREF GI:15156411 LENGTH 122 SQ:AASEQ MAAVSIVFEAPDNYGGAPAVSKKPIDFDHLAQQTMGDKDLEIEVLQLFSRSARAALHEMAGADNKTVTATAHRLKGSAQAVGASAVSAAAAAVEEKGNDSALIAKLAAAIVEAENFILKLCR GT:EXON 1|1-122:0| SEG 76->93|gsaqavgasavsaaaaav| HM:PFM:NREP 1 HM:PFM:REP 45->101|PF01627|1.1e-10|29.8|57/90|Hpt| HM:SCP:REP 24->124|1wn0A1|1.9e-13|29.0|100/0|a.24.10.2|1/1|Histidine-containing phosphotransfer domain, HPT domain| OP:NHOMO 12 OP:NHOMOORG 12 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED cccEEEEEEcccccccccccccccccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHcc //