[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87150.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  74/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.60.1
:169 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->167 2rflH PDBj 2e-67 100.0 %
:RPS:PDB   6->161 2a6pA PDBj 2e-14 18.8 %
:RPS:SCOP  9->164 1bifA2  c.60.1.4 * 3e-12 16.4 %
:HMM:SCOP  5->152 1e58A_ c.60.1.1 * 2e-23 25.9 %
:HMM:PFM   8->73 PF00300 * PGAM 1e-10 22.7 66/158  
:HMM:PFM   92->140 PF07827 * KNTase_C 0.00069 30.6 49/143  
:BLT:SWISS 12->146 Y1276_MYCTU 8e-09 36.7 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87150.1 GT:GENE AAK87150.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(1351878..1352387) GB:FROM 1351878 GB:TO 1352387 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK87150.1 GB:DB_XREF GI:15156420 LENGTH 169 SQ:AASEQ MTASFPTRVYLLRHAKAAWAAPGERDFDRGLNEAGFAEAEIIADLAADRRYRPDLILSSTAARCRQTTQAWQRAFNEGIDIVYIDEMYNARSETYLSLIAAQTEVQSVMLVGHNPTMEATLEAMIGEDLLHAALPSGFPTSGLAVLDQDDSAASGKNRWRLIDFLAPGK GT:EXON 1|1-169:0| BL:SWS:NREP 1 BL:SWS:REP 12->146|Y1276_MYCTU|8e-09|36.7|128/158| SEG 37->50|aeaeiiadlaadrr| BL:PDB:NREP 1 BL:PDB:REP 3->167|2rflH|2e-67|100.0|152/152| RP:PDB:NREP 1 RP:PDB:REP 6->161|2a6pA|2e-14|18.8|149/193| HM:PFM:NREP 2 HM:PFM:REP 8->73|PF00300|1e-10|22.7|66/158|PGAM| HM:PFM:REP 92->140|PF07827|0.00069|30.6|49/143|KNTase_C| RP:SCP:NREP 1 RP:SCP:REP 9->164|1bifA2|3e-12|16.4|146/219|c.60.1.4| HM:SCP:REP 5->152|1e58A_|2e-23|25.9|147/247|c.60.1.1|1/1|Phosphoglycerate mutase-like| OP:NHOMO 77 OP:NHOMOORG 74 OP:PATTERN -------------------------------------------------------------------- -------1---------------------------------111----1------------------1111-----------------------------------1------------------1--11--1-1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-11---------11-1-111111111111-111-------1-121-111121111112--1-----------1------------1-1--------------------------------111----------------------------------------------------1---------------------------------------------------1--1--------------------1---------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------11-1--11111-1--1-------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 168 STR:RPRED 99.4 SQ:SECSTR TcccccccEEEEEccccTTGGGTcccccccccHHHHHHHHHHHHHHHTTcccccEEEEcccHHHHHHHHHTTccGGTTccHHHHHTTcHHHHHHHHHHHHHHTTTccEEEEEcHHHHHHHHHHHTTcccGGGGGGccccTTEEEEEEEETTTEEEETEEEEEEEEccc# DISOP:02AL 1-3| PSIPRED cccccccEEEEEEcccccccccccccccccccHHHHHHHHHHHHHHHHccccccEEEEccHHHHHHHHHHHHHHccccccEEEEcccccccHHHHHHHHHccccccEEEEEEccHHHHHHHHHHHcccHHHHHHcccccccEEEEEEEccccccccccEEEEEEEcccc //