[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87153.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:138 amino acids
:PSIPRED
:DISOPRED
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87153.1 GT:GENE AAK87153.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(1354491..1354907) GB:FROM 1354491 GB:TO 1354907 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAK87153.1 GB:DB_XREF GI:15156423 LENGTH 138 SQ:AASEQ MRGAEQAILPSATVQTEHPSVKSMQDGLSRTKSFMVAEVSNALSSVAVAWWGELKIGSNKKTTAMRRGAGNPSTRDALTIQSLPKRKDCNLHCLPALKERIWRFGGVVAIDASILWGEMNKPCIALKKIVFSCFAFTL GT:EXON 1|1-138:0| TM:NTM 2 TM:REGION 34->55| TM:REGION 117->138| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6, 23-25, 62-73| PSIPRED ccccccccccccEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccEEEcccccHHHHHccccccccccEEEcccccccccccEEEcHHHHHHHHHHccEEEEEEEEEEcccccHHHHHHHHHHHHHHHcc //