[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87158.2
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:113 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   10->106 PF05437 * AzlD 3.4e-14 27.1 96/99  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87158.2 GT:GENE AAK87158.2 GT:PRODUCT hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 1361690..1362031 GB:FROM 1361690 GB:TO 1362031 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAK87158.2 GB:DB_XREF GI:159140019 LENGTH 113 SQ:AASEQ MTDNWWAPYLFIAIAGWLATDLWRWLGVLAGNRLKEDSEALYWVRAVATALVMAVTAKLIVFPTGSLEASPMWLRIGAAILGFIAFLVAGQRVIVGVAVPIVLLAAGLFLRGF GT:EXON 1|1-113:0| TM:NTM 3 TM:REGION 2->24| TM:REGION 42->64| TM:REGION 82->104| SEG 44->57|vravatalvmavta| HM:PFM:NREP 1 HM:PFM:REP 10->106|PF05437|3.4e-14|27.1|96/99|AzlD| OP:NHOMO 9 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-----------1--------------111--1---11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHcccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcc //