[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87159.2
DDBJ      :             transcriptional regulator, LysR family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  362/915 : Eukaryota  3/199 : Viruses  1/175   --->[See Alignment]
a.4.5b.149.1c.94.1
:288 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   26->281 3hhgG PDBj 5e-13 25.7 %
:RPS:PDB   26->125 1cy8A PDBj 2e-16 6.2 %
:RPS:SCOP  9->125 1fokA2  a.4.5.12 * 9e-13 7.7 %
:RPS:SCOP  190->283 1tg7A1  b.149.1.1 * 7e-05 9.5 %
:HMM:SCOP  4->113 1b9mA1 a.4.5.8 * 3.6e-21 34.3 %
:HMM:SCOP  82->283 1uthA_ c.94.1.1 * 9.8e-25 22.9 %
:RPS:PFM   6->64 PF00126 * HTH_1 1e-07 45.8 %
:RPS:PFM   91->248 PF03466 * LysR_substrate 7e-04 29.1 %
:HMM:PFM   88->282 PF03466 * LysR_substrate 8.6e-24 22.8 193/209  
:HMM:PFM   8->64 PF00126 * HTH_1 1e-22 50.9 57/60  
:BLT:SWISS 3->288 GCVA_ECOLI 6e-28 26.6 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87159.2 GT:GENE AAK87159.2 GT:PRODUCT transcriptional regulator, LysR family GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(1362044..1362910) GB:FROM 1362044 GB:TO 1362910 GB:DIRECTION - GB:PRODUCT transcriptional regulator, LysR family GB:PROTEIN_ID AAK87159.2 GB:DB_XREF GI:159140020 LENGTH 288 SQ:AASEQ MTLPPLATLRAFESAARKASFALAAQELGMTATAVSQHVRNLEAWLGVALFERHARGVRLTPAGMEFGNTVSGSLRQIASGAERIRRGHDRMTVRLASLPSVVAHFLTPRLPRFRASHPDIQVSISYSGAQHTSAADLTIGHGISFGENAVALFSAETRPTCAPSYIASAGPFNDEASLLRAELLHDDTETAWRDWFAVGDMSLPYGAGPIFADFNLLVTALKAGQGIGLCPTALLRKEIAEGQLTVLFDRAVDTDKYYWLIRPEEMTASARLLADWLVAEARGSDLK GT:EXON 1|1-288:0| BL:SWS:NREP 1 BL:SWS:REP 3->288|GCVA_ECOLI|6e-28|26.6|286/305| SEG 15->25|aarkasfalaa| BL:PDB:NREP 1 BL:PDB:REP 26->281|3hhgG|5e-13|25.7|253/294| RP:PDB:NREP 1 RP:PDB:REP 26->125|1cy8A|2e-16|6.2|97/563| RP:PFM:NREP 2 RP:PFM:REP 6->64|PF00126|1e-07|45.8|59/60|HTH_1| RP:PFM:REP 91->248|PF03466|7e-04|29.1|151/207|LysR_substrate| HM:PFM:NREP 2 HM:PFM:REP 88->282|PF03466|8.6e-24|22.8|193/209|LysR_substrate| HM:PFM:REP 8->64|PF00126|1e-22|50.9|57/60|HTH_1| GO:PFM:NREP 2 GO:PFM GO:0003700|"GO:transcription factor activity"|PF00126|IPR000847| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00126|IPR000847| RP:SCP:NREP 2 RP:SCP:REP 9->125|1fokA2|9e-13|7.7|117/135|a.4.5.12| RP:SCP:REP 190->283|1tg7A1|7e-05|9.5|84/97|b.149.1.1| HM:SCP:REP 4->113|1b9mA1|3.6e-21|34.3|105/0|a.4.5.8|1/1|"Winged helix" DNA-binding domain| HM:SCP:REP 82->283|1uthA_|9.8e-25|22.9|201/0|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 2023 OP:NHOMOORG 366 OP:PATTERN -------------------------------------------------------------------- 1-----------1-11---------2----------------------------------------1---1--------------------------------------------------------------------------------------------------------------------------------1-1-------1---------1-----------1------------------------------------1--------------------------------------------------------1----------------------------1----1-------------1--6226-1--14196B123561223233323233C-447439446L3-KCC8BHFFGKEH3423318B51352CG2222222243411227------------------------------1295-4F96BMUWRXQA9AA9KKGIBCBB2AZGHECJC-186862A88I494I61641-1-64--111111-1253-----------11-----------111212---------------------------1174211-843315533323734546575464-------------61531655333543334-34435233623344444449A9432324244434334433344G22222221-422222222222---1-----------69C11111111121121154556111215-CCDBFMEG7GHGI6B99----------422744444684877B43633222-------------------------------------------------------------1- --------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------1--------------------1---- --------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------- STR:NPRED 287 STR:RPRED 99.7 SQ:SECSTR EEEEEHHHHHHHHHTTccccHHHHHHHTTcccTTTHHHHHHHHHTTTTccEEEETTEEEEcHHHHHHHHHHHHHcHHHHcHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccGGGTcccccccHHTcccEEHHHHcccccEEEEEEEccGGGccccTTHHHHHHTccTTcEEEEcccccEEEETTEEEEccHHHHHHTcccEEEEEEccHHHHHHHHHHTccEEEEEGGGccHTTTcTTcEEEEccTTcccEEEEEEEETcccHHHHHHHHHHcTTccHcHH# DISOP:02AL 1-1,83-92,285-289| PSIPRED cccccHHHHHHHHHHHHHccHHHHHHHHcccHHHHHHHHHHHHHHHccccEEEccccEEEcHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEccHHHHHHHHHHHHHHHHHHccccEEEEEEccccccccEEEEEcccccccccEEEEEcccEEEEccHHHHHHccccccHHHHHcccEEEcccccHHHHHHHcccccccccccEEEccHHHHHHHHHccccEEEEEHHHHHHHHHccccEEEccccccccccEEEEccccccHHHHHHHHHHHHHHHccccc //