[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87165.2
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  69/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:280 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   22->269 PF08904 * DUF1849 4e-68 53.0 %
:HMM:PFM   23->271 PF08904 * DUF1849 3.2e-99 46.8 248/253  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87165.2 GT:GENE AAK87165.2 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 1366969..1367811 GB:FROM 1366969 GB:TO 1367811 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK87165.2 GB:DB_XREF GI:159140023 LENGTH 280 SQ:AASEQ MFVRTLGFVAATGLMTGLSNAANALPIAVPDLVAHRAVYDLELKDASDRSGIEGMTGRMVYEFTGSACQGYKTDFRFVTQINTGDAVRMTDQQTKTFEDLAAKKFTFETKSYTDDKLDKEVQGAAIDGTDGVKVDLTRPDARQVSLVASEFPTQHMFQVIEHAKQGKRIFESRIFDGSDDGDESLITSTLVGKSQMPKDGDADAGKAGEFAKAAFWPVTIAYYNDKTGTDALPIYRMSFKLYENGITRDLTMDYGDFVLTGKLAKLDILKPETCENKPVR GT:EXON 1|1-280:0| SEG 198->215|kdgdadagkagefakaaf| RP:PFM:NREP 1 RP:PFM:REP 22->269|PF08904|4e-68|53.0|247/253|DUF1849| HM:PFM:NREP 1 HM:PFM:REP 23->271|PF08904|3.2e-99|46.8|248/253|DUF1849| OP:NHOMO 69 OP:NHOMOORG 69 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111111111111111111111111-11111111111-11111111111111-------------11111111111-1111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,197-207,274-281| PSIPRED ccEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEEEEEEccccccccccEEEEEEEEEccccccEEEEEEEEEEEEEEccccEEEEEEEEEEEcccccEEEEEEEcccccccHHHHcccEEEcccccEEEEEcccccEEEEccccccHHHHHHHHHHHHHcHHHcccccccccccccEEEEEEEEEccccccccccccHHHHcHHHccccEEEEEEEcccccccccccEEEEEEEEEccccEEEEEEEEccEEEEEEEcccEEcccccccccccc //