[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87172.2
DDBJ      :             zinc metallopeptidase
Swiss-Prot:Y1380_AGRT5  RecName: Full=Putative zinc metalloprotease Atu1380;         EC=3.4.24.-;

Homologs  Archaea  0/68 : Bacteria  796/915 : Eukaryota  14/199 : Viruses  0/175   --->[See Alignment]
b.36.1
:377 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   146->232 3id4A PDBj 4e-10 35.4 %
:RPS:PDB   148->208 3cs0A PDBj 6e-13 21.7 %
:RPS:SCOP  149->214 1k32A1  b.36.1.3 * 6e-12 22.7 %
:HMM:SCOP  120->217 1sotA1 b.36.1.4 * 6.7e-20 33.7 %
:RPS:PFM   18->368 PF02163 * Peptidase_M50 2e-42 36.8 %
:HMM:PFM   18->371 PF02163 * Peptidase_M50 7.3e-63 41.7 192/193  
:BLT:SWISS 1->377 Y1380_AGRT5 0.0 100.0 %
:PROS 26->35|PS00142|ZINC_PROTEASE
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87172.2 GT:GENE AAK87172.2 GT:PRODUCT zinc metallopeptidase GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 1373181..1374314 GB:FROM 1373181 GB:TO 1374314 GB:DIRECTION + GB:PRODUCT zinc metallopeptidase GB:PROTEIN_ID AAK87172.2 GB:DB_XREF GI:159140027 LENGTH 377 SQ:AASEQ MNTIMAATGFLTGYIVPFILVLSLLVFVHEMGHYLVGRWCGIRSTAFSIGFGPELIGFTDKRGTRWKLSAIPLGGYVKFFGDEDAASKSDSSGLSHMSLEERAQTLSGAKLWKRAATVAAGPIANFILAILIFAVLFGIYGRMIADPVVAEVRENSAAATAGVKPGDRLVAIDGEKVMTFEDVRRYVGIRPGTPITVTVERAGEELKLPMVPTRTETTDQFGNKLEMGIIGIVTDQTSGNFRHIEYSPSEAVAEGVRETGHVITGTFNYIGNLVTGRMNADQLGGPVRVAQASGQMATLGISAVIQLAAVLSVSIGLLNLMPVPVLDGGHLVFYAIEAIRGRPLGAGAQEVAFRIGMMMILGLMVFATWNDISSLIG GT:EXON 1|1-377:0| SW:ID Y1380_AGRT5 SW:DE RecName: Full=Putative zinc metalloprotease Atu1380; EC=3.4.24.-; SW:GN OrderedLocusNames=Atu1380; ORFNames=AGR_C_2553; SW:KW Cell inner membrane; Cell membrane; Complete proteome; Hydrolase;Membrane; Metal-binding; Metalloprotease; Protease; Transmembrane;Zinc. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->377|Y1380_AGRT5|0.0|100.0|377/377| GO:SWS:NREP 8 GO:SWS GO:0005886|"GO:plasma membrane"|Cell inner membrane| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0008237|"GO:metallopeptidase activity"|Metalloprotease| GO:SWS GO:0008233|"GO:peptidase activity"|Protease| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| PROS 26->35|PS00142|ZINC_PROTEASE|PDOC00129| TM:NTM 4 TM:REGION 6->28| TM:REGION 123->145| TM:REGION 308->330| TM:REGION 349->371| SEG 123->139|ianfilailifavlfgi| BL:PDB:NREP 1 BL:PDB:REP 146->232|3id4A|4e-10|35.4|82/93| RP:PDB:NREP 1 RP:PDB:REP 148->208|3cs0A|6e-13|21.7|60/379| RP:PFM:NREP 1 RP:PFM:REP 18->368|PF02163|2e-42|36.8|318/331|Peptidase_M50| HM:PFM:NREP 1 HM:PFM:REP 18->371|PF02163|7.3e-63|41.7|192/193|Peptidase_M50| GO:PFM:NREP 2 GO:PFM GO:0004222|"GO:metalloendopeptidase activity"|PF02163|IPR008915| GO:PFM GO:0006508|"GO:proteolysis"|PF02163|IPR008915| RP:SCP:NREP 1 RP:SCP:REP 149->214|1k32A1|6e-12|22.7|66/91|b.36.1.3| HM:SCP:REP 120->217|1sotA1|6.7e-20|33.7|98/99|b.36.1.4|1/1|PDZ domain-like| OP:NHOMO 840 OP:NHOMOORG 810 OP:PATTERN -------------------------------------------------------------------- 1111--11---1--11111-11---111111-1---11---1-1--11---1111-1111---1111--11---------1-111111111--1111--111-11111111111111-------111122211111111-1111111111111--111--1-1-11211-1111-111-1-111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111111111111-1111111-1111111111111111111111111111-11112111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112222222111111111111111112112-11111111111111111111111111111111111111-11111------11111111111111111-111111111111111111111111111111111111111111111111111111111111111111111121--22221111111111111111111111111111111111111111111111111---------1111111111111111111111111111111111111111----1-1111-------------------------111111111111- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---7111113--2-21111---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 90 STR:RPRED 23.9 SQ:SECSTR ##############################################################################################################################################ccccEEEcccccccTTGGGTccTTcEEccccccccccHHHHHHHHHcTcccccEEEEEETTEEEEHHHHTcccTTcccccccccEEEccE################################################################################################################################################# DISOP:02AL 84-98,213-226| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccEEEEEEEEccccEEEEEccccEEEEEEEEEEccEEccccccccccccccccHHcccHHHHccHHHcccHHHHHHHHHccccHHHHHHHHHHHcccccccEEEcccEEEEEccccHHHHcccccccEEEEEccEEcccHHHHHHHHHHccccEEEEEEEEccEEEEEEEEEEEEccccccccccccEEEEEEEccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHc //