[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87181.1
DDBJ      :             ABC transporter, membrane spanning protein
Swiss-Prot:             

Homologs  Archaea  29/68 : Bacteria  649/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
f.58.1
:223 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   117->157 3dhwA PDBj 1e-06 32.4 %
:RPS:SCOP  5->198 2r6gG1  f.58.1.1 * 2e-14 10.8 %
:RPS:PFM   90->162 PF00528 * BPD_transp_1 7e-05 30.4 %
:HMM:PFM   35->207 PF00528 * BPD_transp_1 3.4e-17 20.7 169/185  
:BLT:SWISS 60->198 GLNM_BACSU 2e-20 33.1 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87181.1 GT:GENE AAK87181.1 GT:PRODUCT ABC transporter, membrane spanning protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 1383069..1383740 GB:FROM 1383069 GB:TO 1383740 GB:DIRECTION + GB:PRODUCT ABC transporter, membrane spanning protein GB:PROTEIN_ID AAK87181.1 GB:DB_XREF GI:15156457 LENGTH 223 SQ:AASEQ MKYTFDFGWLLEYYPQIAKGIAITLELIAIGGVLGIALGIFCAWVRALGPKWLRPPVATYVELIRNTPFLIQLFFIFFGLPSLGLQLSELSAANIAMVVNLGAYSCEIIRAGIQATPKGQFEAGASLAMTRFETFRHVVLVPSLQRIWPALSSQVVIVMLGSSVVSQIAAEDLTFAANFIQSRTFRAFEAYMVSTVIYLVLAILLRQLLVMGGNLIFPRRSVR GT:EXON 1|1-223:0| BL:SWS:NREP 1 BL:SWS:REP 60->198|GLNM_BACSU|2e-20|33.1|139/216| TM:NTM 5 TM:REGION 20->42| TM:REGION 60->82| TM:REGION 89->111| TM:REGION 149->171| TM:REGION 192->214| SEG 25->40|leliaiggvlgialgi| SEG 69->78|fliqlffiff| SEG 199->209|lvlaillrqll| RP:PDB:NREP 1 RP:PDB:REP 117->157|3dhwA|1e-06|32.4|37/203| RP:PFM:NREP 1 RP:PFM:REP 90->162|PF00528|7e-05|30.4|69/195|BPD_transp_1| HM:PFM:NREP 1 HM:PFM:REP 35->207|PF00528|3.4e-17|20.7|169/185|BPD_transp_1| GO:PFM:NREP 3 GO:PFM GO:0005215|"GO:transporter activity"|PF00528|IPR000515| GO:PFM GO:0006810|"GO:transport"|PF00528|IPR000515| GO:PFM GO:0016020|"GO:membrane"|PF00528|IPR000515| RP:SCP:NREP 1 RP:SCP:REP 5->198|2r6gG1|2e-14|10.8|194/284|f.58.1.1| OP:NHOMO 3149 OP:NHOMOORG 682 OP:PATTERN 11--12----------1-1111113--11-211-----1122--1112--1-1----2------1--- ----3---------2------2---9------3222-28514224-51111-4361-4---12-5464251322232221311---------------------------11111111111111-----1--4---111221111---111112222-------1--2221----------1-1341111--2545555577556555662338555633344434444438622222222222222222224664699755566655993757743337776555399777677667775555455555555657876777713345453435423224222333212213133199-4132-1111111151--1111-1-1---I56--1----12243234334L-22B22A168E-2aKKJIKMKLUCDG8----2G3345-351111111133411-24----------111111111111111--1-2--1--4EBADHFFEHE87999BBER9AAA89A9P46841276B847548AEDIN244----533322222---24--1D-696C35AAA942-23-3----------4-3341555553232222222-13----446-2-----7-1111--11111111-11-1---1--------58EE5896665665665-66766666666665665569E8GF4443533333333333333B44455451-977777767777--1-111111111--45833342433223333122222-22331-B9ABBGFI7BB8A5ECD----------3335444446654411---------------2----------------3-------------------------132-115111--1 --------------------------------------------------------------------------------------------------------------------------------------------------------------2----1------1-----------------2---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 37 STR:RPRED 16.6 SQ:SECSTR ####################################################################################################################cTTTTTHHHHHTccTHHHHHHTTHHHHH####HHHHHHHHH################################################################## DISOP:02AL 219-223| PSIPRED cccEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //