[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87189.1
DDBJ      :             ABC transporter, membrane spanning protein (amino acid)
Swiss-Prot:             

Homologs  Archaea  29/68 : Bacteria  691/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
f.58.1
:217 amino acids
:PSIPRED
:DISOPRED
:RPS:PDB   111->139 3dhwA PDBj 3e-05 41.4 %
:RPS:SCOP  3->214 2r6gG1  f.58.1.1 * 5e-20 14.2 %
:HMM:PFM   32->209 PF00528 * BPD_transp_1 8e-20 20.3 172/185  
:BLT:SWISS 9->197 YCKA_BACSU 9e-29 30.2 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87189.1 GT:GENE AAK87189.1 GT:PRODUCT ABC transporter, membrane spanning protein (amino acid) GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(1391987..1392640) GB:FROM 1391987 GB:TO 1392640 GB:DIRECTION - GB:PRODUCT ABC transporter, membrane spanning protein (amino acid) GB:PROTEIN_ID AAK87189.1 GB:DB_XREF GI:15156465 LENGTH 217 SQ:AASEQ MSTFGWPEFLFLLRGAGWSIVLTAIAFSIGSLTGGFFAIMRLSQYGSVRNVAAGYITVIQSIPVLMILFMSYYGLTLFGFEIPPLLAASVSLSVYVSAYLAEIWRGSIQAVPKPQWEASASLALTRFQQYRYVILPQALRLSLPPTVGFLVQLVKNTSIVSVVGFVELSRAGQLVNNATFRPFQVFFVVALLYFAICFPLSRLSRHLERVLHVGRNN GT:EXON 1|1-217:0| BL:SWS:NREP 1 BL:SWS:REP 9->197|YCKA_BACSU|9e-29|30.2|189/226| TM:NTM 5 TM:REGION 14->36| TM:REGION 49->71| TM:REGION 78->100| TM:REGION 146->168| TM:REGION 180->202| SEG 85->101|llaasvslsvyvsayla| RP:PDB:NREP 1 RP:PDB:REP 111->139|3dhwA|3e-05|41.4|29/203| HM:PFM:NREP 1 HM:PFM:REP 32->209|PF00528|8e-20|20.3|172/185|BPD_transp_1| RP:SCP:NREP 1 RP:SCP:REP 3->214|2r6gG1|5e-20|14.2|212/284|f.58.1.1| OP:NHOMO 4171 OP:NHOMOORG 724 OP:PATTERN 11--12----------1-1111112--11-221-----1122--1211--1-1----2------1--- ----32113332214------5---A------555523C713113172433-648125--222-577A493555554431421---------------------------11111111111111-----1--4---122441111-12232233322111-1--1--3322-1111--1111-1341111--26455555875566556623398556333644255555386222222222222222222236757AB865676655B93757B533388885665AA89978788888666656666666676898788881355745343442323444233331-21423319A-4132-1111111161--11135324421K56112311122475347566Q-22F22C28EH13qSSMVXQWViLKN9---14I54573491111111134511-48----------111111111111111--1-4--21-4FDAGKIIHJHA5999CCIVA9AA9AFDZ679312A9C94754A9HFLP233----A44422222---25--1H-896C46BAAA42-23-3----------3-3331666662131111111-12----77A-3-----A-1111--11111111-11-1---1--------98JK5BA9999997998-99B9999999999899889EHDKK6669786999999999979D78788881-DBBBBBAABBBB--5-222221111--66B44452522212222144554-43443-GEEGHPKQ9HHDE5KIK----------5558999999977711---------------2----------------31-1----------------------132-115111--1 --------------------------------------------------------------------------------------------------------------------------------------------------------------1----1------6-----------------2---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 213-217| PSIPRED cccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccc //