[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87190.2
DDBJ      :             ABC transporter, membrane spanning protein (amino acid)
Swiss-Prot:             

Homologs  Archaea  29/68 : Bacteria  681/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
f.58.1
:234 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   17->143 3dhwA PDBj 2e-07 23.8 %
:RPS:SCOP  17->222 2r6gG1  f.58.1.1 * 1e-19 11.7 %
:HMM:PFM   33->213 PF00528 * BPD_transp_1 5.6e-18 21.8 174/185  
:BLT:SWISS 17->193 GLNP_RICBR 4e-24 29.4 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87190.2 GT:GENE AAK87190.2 GT:PRODUCT ABC transporter, membrane spanning protein (amino acid) GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(1392640..1393344) GB:FROM 1392640 GB:TO 1393344 GB:DIRECTION - GB:PRODUCT ABC transporter, membrane spanning protein (amino acid) GB:PROTEIN_ID AAK87190.2 GB:DB_XREF GI:159140032 LENGTH 234 SQ:AASEQ MNFSLHFEAVFAESDLIWRGILLTIGLSATAIVLGTMIAVALVAMRSLGNGTIRFCVDSYVELLRNTPFLVQLFMVFFGLPLVGFRMSGTQAALFAMTLNLSAYATEIIRAGVESIHRSQVEAGLSLSLSRLQVFRYVVMKPAFAKIWPALSSQFVLMLLASSICSFISVPELSGAASIIEQRTFRSFETYIVVTVIYLLLALALKIILAWFGHWLFRRRVKVFSPMTVQEGIA GT:EXON 1|1-234:0| BL:SWS:NREP 1 BL:SWS:REP 17->193|GLNP_RICBR|4e-24|29.4|177/218| TM:NTM 5 TM:REGION 4->26| TM:REGION 31->53| TM:REGION 61->83| TM:REGION 158->180| TM:REGION 196->217| SEG 197->210|iylllalalkiila| BL:PDB:NREP 1 BL:PDB:REP 17->143|3dhwA|2e-07|23.8|126/203| HM:PFM:NREP 1 HM:PFM:REP 33->213|PF00528|5.6e-18|21.8|174/185|BPD_transp_1| RP:SCP:NREP 1 RP:SCP:REP 17->222|2r6gG1|1e-19|11.7|206/284|f.58.1.1| OP:NHOMO 3656 OP:NHOMOORG 714 OP:PATTERN 11--12----------1-1111113--11-221-----1122--1122--1-1----2------2--- ----41122221213------3---A------433323A714224-41111-4471-4--211-4568472622232231421---------------------------11111111111111-----1--4----11221111-11232221111-1-----1--3321--112---212-1341111--27455555775565556623398556333653355555386222222222222222222246657AA885666666A93757B43338888666499888777888876666566666666668BA98888134575645455232244423333122142331AA-4132-1111111171--11114333311L6612-311112364336456N-22E22C28BG-2lRRNPRPQRbGIN9----1G43461271111111124511-16----------111111111111111--1-4--2--4FDAGHHHFJF9799A99GRAAAA8ADCV7794-286C94754AAGEKN244----744422222---24--1H-896C56B99932-23-3-------1--4-3341555553332222222-13----877-2-----9-1111--11111111-11-1---1--------56EF5765555554555-5575555555555455445BEAGF7667574767776778758B55455651-999999989999--4-222221111--56955542533223322233333-63441-A88ACLGN7AD894IEG----------5458666666665511---------------2----------------3314----------------------122-114111--1 --------------------------------------------------------------------------------------------------------------------------------------------------------------2----1------6-----------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 126 STR:RPRED 53.8 SQ:SECSTR ################HHHHHHHHHHHHHHHHHTTGGGGGGGGGGTTcccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHTTcccc#cHHHHHHHHHHHHHHHHHHHHHHHHHHccTTTTTHHHHHTccTHHHHHHTTHHHH########################################################################################### DISOP:02AL 222-235| PSIPRED ccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHcccc //