[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87208.2
DDBJ      :             long-chain-fatty-acid-CoA-ligase
Swiss-Prot:             

Homologs  Archaea  4/68 : Bacteria  477/915 : Eukaryota  72/199 : Viruses  0/175   --->[See Alignment]
e.23.1
:611 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   65->529 2d1rA PDBj 8e-12 26.1 %
:RPS:PDB   30->510 2d1tA PDBj 6e-33 19.7 %
:RPS:SCOP  17->465 1ba3A  e.23.1.1 * 1e-33 21.1 %
:HMM:SCOP  21->596 1pg4A_ e.23.1.1 * 2.2e-77 26.2 %
:RPS:PFM   200->440 PF00501 * AMP-binding 1e-20 34.1 %
:HMM:PFM   65->482 PF00501 * AMP-binding 5.6e-51 23.7 396/418  
:BLT:SWISS 64->443 LCFB_BACSU 6e-17 33.3 %
:PROS 208->219|PS00455|AMP_BINDING

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87208.2 GT:GENE AAK87208.2 GT:PRODUCT long-chain-fatty-acid-CoA-ligase GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(1411543..1413378) GB:FROM 1411543 GB:TO 1413378 GB:DIRECTION - GB:PRODUCT long-chain-fatty-acid-CoA-ligase GB:PROTEIN_ID AAK87208.2 GB:DB_XREF GI:159140039 LENGTH 611 SQ:AASEQ MSVKLWSPDVAWEKRPNGEIMIWRNDPLGPYPQKLNERLLHWCRSAPERTWMADRQGREPWRRVSYAEALDKIRRIGQFLLDHDLSVERPLLVLSENSIEHALMVLAAQHVGIASAAITPAYATSADLTKLADIRGQITPGMVFAEDATPFRRALGEVFDDGTPLVGLRNLPEDRSNTFHFETLLETEPTEAVDRAFDAVGPDTVAKFLFTSGTTGSPKAVIQTQRMLCSNQEMIADCYGYFREEPPVVVDWAPWNHTAAGNKVFNLVLYNGGTYYIDRGKPSPAQIGQTLDNLRDISPTWYFNVPAGHEMLVQAMRKDEALCRSFFRDLKMLMYAGAGMAQHTWDALTELSMATVGHAVLMGAGLGSTETAPFSLFCTEPQDKPGNIGIPAQGVTMKLVPFDGRYELRLKGPNITPGYWRNGELTAAAFDEEGFYRIGDTVKFAVADDPRRGFYFDGRMAENFKLQTGTWVAVGPLRAQLVNMFAGLIRDAVITGENRAELGALVVPFIPALRELVRGSQHLSDAEIIRHPSVRAQIVAKLSAHQKQASGSASRVMRILVMEDALRFEKGEVTDKGSINQRAVLLHRKELVESLYGDTPQVITVGREVAA GT:EXON 1|1-611:0| BL:SWS:NREP 1 BL:SWS:REP 64->443|LCFB_BACSU|6e-17|33.3|348/513| PROS 208->219|PS00455|AMP_BINDING|PDOC00427| BL:PDB:NREP 1 BL:PDB:REP 65->529|2d1rA|8e-12|26.1|422/537| RP:PDB:NREP 1 RP:PDB:REP 30->510|2d1tA|6e-33|19.7|452/538| RP:PFM:NREP 1 RP:PFM:REP 200->440|PF00501|1e-20|34.1|223/405|AMP-binding| HM:PFM:NREP 1 HM:PFM:REP 65->482|PF00501|5.6e-51|23.7|396/418|AMP-binding| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF00501|IPR000873| GO:PFM GO:0008152|"GO:metabolic process"|PF00501|IPR000873| RP:SCP:NREP 1 RP:SCP:REP 17->465|1ba3A|1e-33|21.1|421/540|e.23.1.1| HM:SCP:REP 21->596|1pg4A_|2.2e-77|26.2|526/643|e.23.1.1|1/1|Acetyl-CoA synthetase-like| OP:NHOMO 902 OP:NHOMOORG 553 OP:PATTERN -----------------------11--2---2------------------------------------ 112-2221222211-2111-112212111111312111351------2-1111-11----122113241122111111----41----11---111---1-1-1111-21---------------11111-1112-22232---4-1112---1111-111--1---2131-1-----1--1-1-111--1211111111111111111--1111111111212-------2--------------------1--------------------------------------------------------------------------1-----------------------2--1----------1-11----1--2334-----1168A12441644------------11111222124-111212122222-12214311-22213-------------331---------------------------------2-111-23222321123122312221133323442-1-111121112233---11-1-11-------11122126-1-1-1-11111--111-11-313222211------------------------1--11-11----11322222312212-112212---1211-------11121-1--1111111--111111111-11111111111-11111-1111111111111111111111--111111111111---------22221-222111-11-11111--122112111113122222134232332344----------23323333322222-1222222221111--1-11--11--------21--------------------------------------- --------------31312233231251111112-1211--2211111-2---2--2-24131-----------2---------------213---------18-4-3--6---------------1-------------------------------1---1-----11-1211------12-552231322-11-11 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 539 STR:RPRED 88.2 SQ:SECSTR ################ccTTcEEcccccccccccHHHHHHHHHHHHHHHTcEEEEETTTTccEEEHHHHHHHHHHHHHHHHHHTccTTcEEEEEccccTTTHHHHHHHHHHTcEEEEEcTTcHHHHHHHHHHcccEEEEcTTETHHHHHHHHHHcTTcTTcccccTTcccHHHHHHEEHHTccTTccGGGccTTTcccccTTTcEEEEEcccccccccccEEEEHHHHHHHHHHHTcTTTcccccTTcEEEEcccTTcHHHHHHHHHHHHHTcEEEEcccEcccccHHHHHHHHHHTTccEEEEcGGGHHHHHHcccGGccGGGcccTTccEEEEEcccccHHHHHHHHHHHHHHHTTccccEEEEEcGGGccEEEEccTTcccTTcccEEcTTcEEEEEcTTTccEEEEEcTTcccEETTcHHHHHHHccTTccEEEEEEEEEEEEEccTTccEEEEEEGGGccccTTccccHHHHHHHHHTcTTTTEEEEEEEEEEETTTEEEEEEEEEEcccccHHHHHHHHHHHccGGGcccEEEcEcccccccTTccccG######################################################## DISOP:02AL 611-612| PSIPRED ccccccccHHHccccccccEEEEccccccHHHccHHHHHHHHHHHccccEEEEEccccccEEEEEHHHHHHHHHHHHHHHHHcccccccEEEEEccccHHHHHHHHHHHHHccEEEEccccccHHHHHHHHHHHHcccccEEEEEcccHHHHHHHHHHcccccEEEEEEcccccccccccHHHHHHccccccccccccccccccEEEEEEcccccccccEEEEcHHHHHHHHHHHHHHccccccccEEEEEEccHHHHHHHHHHHHHHHHHccEEEEccccccHHHHHHHHHHHHHHcccEEEcccHHHHHHHHHHHccccccccccccccEEEEccccccHHHHHHHHHHHcccccccEEEEEccccHHHHcEEEcccccccccccccccccccEEEEEcccccEEEEEEcHHHHcHHcccHHHHHHHHcccccEEccEEEEEEcccccccEEEEEEEEccEEEEcccEEEEcHHHHHHHHHHcccccEEEEEEEccHHHcccEEEEEHHHHHHHHcccccccHHHHHccHHHHHHHHHHHHHHHHccccccccccEEEEcccccccccccccccccccHHHHHHHHHHHHHHHHcccccEEEEEEEEcc //