[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87222.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:96 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:HMM:PFM   4->39 PF00194 * Carb_anhydrase 4.4e-05 25.0 36/256  
:HMM:PFM   30->67 PF02272 * DHHA1 0.00082 29.4 34/68  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87222.1 GT:GENE AAK87222.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 1426138..1426428 GB:FROM 1426138 GB:TO 1426428 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAK87222.1 GB:DB_XREF GI:15156504 LENGTH 96 SQ:AASEQ MNLSKIKQILPATENWYRVLGSKAAPQFERVVFWAVINDGEGDVIAGVPREYIGVIGAVSEWLNDVAGYIEVSPSQLDRLAEHPEELEQYNLVWGD GT:EXON 1|1-96:0| HM:PFM:NREP 2 HM:PFM:REP 4->39|PF00194|4.4e-05|25.0|36/256|Carb_anhydrase| HM:PFM:REP 30->67|PF02272|0.00082|29.4|34/68|DHHA1| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 51 STR:RPRED 53.1 SQ:SECSTR ################EEEETTEEEE#######EEEcccTTTTccccccccEEEEEcccccEEcTTccEEEcGG###################### DISOP:02AL 1-5| PSIPRED ccHHHHHHHccccHHHHHHHcccccccHHHEEEEEEEEcccccEEEcccHHHHHHHHHHHHHHHHHHHHEEccHHHHHHHHHcHHHHHHccccccc //