[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87226.2
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  8/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:82 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   34->82 PF04226 * Transgly_assoc 9.1e-15 43.8 48/48  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87226.2 GT:GENE AAK87226.2 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 1430050..1430298 GB:FROM 1430050 GB:TO 1430298 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK87226.2 GB:DB_XREF GI:159140047 LENGTH 82 SQ:AASEQ MESVGWIAAIIIGGLAGWLAGKLMDMRFGIFMNIILGIVGSVVAVAVLRTLDVFVQDSRLGYFVTSFLGASLLLFVAKLVRR GT:EXON 1|1-82:0| TM:NTM 3 TM:REGION 2->24| TM:REGION 28->50| TM:REGION 59->80| SEG 5->21|gwiaaiiigglagwlag| HM:PFM:NREP 1 HM:PFM:REP 34->82|PF04226|9.1e-15|43.8|48/48|Transgly_assoc| OP:NHOMO 11 OP:NHOMOORG 8 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11122-112--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //