[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87247.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  26/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:104 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   4->87 PF11011 * DUF2849 2e-08 47.6 %
:HMM:PFM   4->91 PF11011 * DUF2849 5.5e-31 46.5 86/90  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87247.1 GT:GENE AAK87247.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 1451329..1451643 GB:FROM 1451329 GB:TO 1451643 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK87247.1 GB:DB_XREF GI:15156533 LENGTH 104 SQ:AASEQ MVDKVLTANRLSDGIAVWLDANGEWTENLQDAIVARHAEAVASFEEIGKRDFSANKVVDVNVVDVVEENGKLWPTRLRERIRAAGPTMHYATGYKPADAAFIAV GT:EXON 1|1-104:0| SEG 57->69|vvdvnvvdvveen| RP:PFM:NREP 1 RP:PFM:REP 4->87|PF11011|2e-08|47.6|82/90|DUF2849| HM:PFM:NREP 1 HM:PFM:REP 4->91|PF11011|5.5e-31|46.5|86/90|DUF2849| OP:NHOMO 26 OP:NHOMOORG 26 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111111---------11--1111111111111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 104-105| PSIPRED cccEEEEcccccccEEEEEccccccEEEEccEEEEEccHHHHHHHHHHHHHHcccEEEccEEEEEEEccccEEEEEHHHHHHHcccccccccccccccccHHcc //