[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87257.2
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  13/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:126 amino acids
:PSIPRED
:DISOPRED

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87257.2 GT:GENE AAK87257.2 GT:PRODUCT hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 1463055..1463435 GB:FROM 1463055 GB:TO 1463435 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAK87257.2 GB:DB_XREF GI:159140058 LENGTH 126 SQ:AASEQ MLRIFCATLMLSLGFAHKPALAVSPQVVLDESYRLPDGTFAEICLGHVGGVNASHTKDGPAHSGDAILFCEACLLASSILLPMPDMEGWLKKEFAWLDNRLSAEWSVHSVLTIQQPSARGPPALSS GT:EXON 1|1-126:0| OP:NHOMO 13 OP:NHOMOORG 13 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1-1-1111--------------111--11--1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 50-66,119-127| PSIPRED cHHHHHHHHHHHHcccccccHHccccEEEEEEEEcccccEEEEEEEcccccccccccccccccccccccccHHHHHHHHEEccHHHHHHHHHHHHHHHHcccccEEEEEEEEEEcccccccccccc //