[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87264.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  8/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:162 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   95->128 PF03783 * CsgG 0.00037 32.4 34/209  
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87264.1 GT:GENE AAK87264.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 1468232..1468720 GB:FROM 1468232 GB:TO 1468720 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAK87264.1 GB:DB_XREF GI:15156554 LENGTH 162 SQ:AASEQ MTTTLKRLGILVLASFVLMSFRLEPEATNTDRLLYDVRGAFVAARPDVAPALMQSIHAQVQNAIKITARGETRPRVVLTIRLASVKRAPFLFGERASAKVIVRAAAVATGEVIAEAKFTATVVSFDNQSIEQELAYGVAERVIHEFRLNRPGPTTLATALFP GT:EXON 1|1-162:0| TM:NTM 1 TM:REGION 8->30| HM:PFM:NREP 1 HM:PFM:REP 95->128|PF03783|0.00037|32.4|34/209|CsgG| OP:NHOMO 8 OP:NHOMOORG 8 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111-111--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3| PSIPRED cccHHHHHHHHHHHHHHHHHHcccccccccHHHHEEcccEEEEEcccccHHHHHHHHHHHHHHEEEEEccccccEEEEEEEEcccccccEEEcccccHHEEEHHHHHHHHHHHHHHHHEEEEEEcccHHHHHHHHHHHHHHHHHHHHcccccccHHHEEccc //