[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87269.2
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  11/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:150 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 69->143 DCL3B_ORYSJ 6e-04 28.4 %
:REPEAT 2|41->76|114->150

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87269.2 GT:GENE AAK87269.2 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 1471602..1472054 GB:FROM 1471602 GB:TO 1472054 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK87269.2 GB:DB_XREF GI:159140682 LENGTH 150 SQ:AASEQ MLEEFIVQAKSATYVGGGDKSATPTRQGSHDLGYREGDWHYVDSYFGGTDFIGQEVVWHQGTAVWAMSYYGRILRPDMIDGTTAGMVIQRSLSTLYREGRFLGGFTHPVENLIYVDTNAGEFESFTGVERIYRGHVETYRLDYHGGIIKP GT:EXON 1|1-150:0| BL:SWS:NREP 1 BL:SWS:REP 69->143|DCL3B_ORYSJ|6e-04|28.4|74/1637| NREPEAT 1 REPEAT 2|41->76|114->150| OP:NHOMO 11 OP:NHOMOORG 11 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------1-----------------------------------------------------------------------------------11--111111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1| PSIPRED cHHHHHHHHHcccccccccccccccccccEEEEEEcccEEEEEEEEcccEEEEEEEEEEccccEEEEEEEcHHccccccccHHHHHHHHHHHHHHHHHccccccEEcccccEEEEEcccccccccccHHHHEEccEEEEEEEEcccEEcc //