[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87270.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  55/68 : Bacteria  705/915 : Eukaryota  196/199 : Viruses  0/175   --->[See Alignment]
c.47.1
:218 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->217 2v2gD PDBj 1e-52 47.1 %
:RPS:PDB   2->217 2cv4D PDBj 2e-39 32.0 %
:RPS:SCOP  3->217 1prxA  c.47.1.10 * 7e-42 48.6 %
:HMM:SCOP  1->218 1x0rA1 c.47.1.10 * 1.3e-70 47.8 %
:RPS:PFM   5->144 PF00578 * AhpC-TSA 6e-21 47.9 %
:RPS:PFM   165->188 PF10417 * 1-cysPrx_C 1e-04 62.5 %
:HMM:PFM   5->143 PF00578 * AhpC-TSA 1.6e-35 42.1 121/124  
:HMM:PFM   165->202 PF10417 * 1-cysPrx_C 2.8e-16 47.4 38/40  
:BLT:SWISS 3->215 PRX1_YEAST 2e-63 56.9 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87270.1 GT:GENE AAK87270.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(1472110..1472766) GB:FROM 1472110 GB:TO 1472766 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK87270.1 GB:DB_XREF GI:15156560 LENGTH 218 SQ:AASEQ MSLRINDIAPDFTAETTQGPVRFHDWIGDGWAVLFSHPKNFTPVCTTELGAMGGLQPEFEKRGVKIIGISVDPVESHEKWKADIRTATGFNVDYPLIGDKDLKVAKLYDMLPAGAGDSSEGRTPADNATVRSVFVIGPDKKIKLVLTYPMTTGRNFDEILRAIDSIQLTSKHQVATPANWKQGEDVIITAAVSNEDAIARFGSYDTVLPYLRKTKQPG GT:EXON 1|1-218:0| BL:SWS:NREP 1 BL:SWS:REP 3->215|PRX1_YEAST|2e-63|56.9|209/261| BL:PDB:NREP 1 BL:PDB:REP 3->217|2v2gD|1e-52|47.1|210/219| RP:PDB:NREP 1 RP:PDB:REP 2->217|2cv4D|2e-39|32.0|203/237| RP:PFM:NREP 2 RP:PFM:REP 5->144|PF00578|6e-21|47.9|121/122|AhpC-TSA| RP:PFM:REP 165->188|PF10417|1e-04|62.5|24/37|1-cysPrx_C| HM:PFM:NREP 2 HM:PFM:REP 5->143|PF00578|1.6e-35|42.1|121/124|AhpC-TSA| HM:PFM:REP 165->202|PF10417|2.8e-16|47.4|38/40|1-cysPrx_C| GO:PFM:NREP 3 GO:PFM GO:0016209|"GO:antioxidant activity"|PF00578|IPR000866| GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF00578|IPR000866| GO:PFM GO:0051920|"GO:peroxiredoxin activity"|PF10417|IPR019479| RP:SCP:NREP 1 RP:SCP:REP 3->217|1prxA|7e-42|48.6|210/220|c.47.1.10| HM:SCP:REP 1->218|1x0rA1|1.3e-70|47.8|207/0|c.47.1.10|1/1|Thioredoxin-like| OP:NHOMO 1974 OP:NHOMOORG 956 OP:PATTERN 111111422222222312112221-----1----111111211-1-1111112-121223354311-1 2121-111---21111111-1-11211111121---223112-2---1---------------1-1-211--111112-112-211112211-2111--113232232-211111111111111122232122222---111114-54544434444111212324455441111121111111111122-32-111111-111-11--221111---2131---111111411-----------------111-1-11-1-----1111---11-1111111111-11-----------1111111111111---------1121-------------111-11-211111----112---11--222-1111112112-----321112211112122212221221-11-111--121-311-1111111122-21111----111222222221553311211111111111111111111111111111-2141122224444444344444455444434546423411332-2111113122221152511-------122122213--111122112-3242232-1323313--2221122222111111112111122222223422222-22222232222221222221-131--11111121221211111111111-11211111111111111112222211222222222222222221111111111111111111111111233333212223122---1-1-1--1-111222221322223555533332333322222-1111-1-211121111122222222222222222221111333333--------11--------------------------1111111111111 3311545-A83-3332243233222221111111111111111111221123231111111133333323333332322334232211-34122322222211445132296C66584143353C7271EQ8166B2333935753454362254555655434442A5573444133183213543744342195B63 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 218 STR:RPRED 100.0 SQ:SECSTR GcccTTcccccEEEETTEEEETHHHHTTTcEEEEEEccccccHHHHHHHHHHHHTHHHHHHTTEEEEEEEcccHHHHHHHHHHHHHHHcccccccEEEccccHHHHHTTcccTTccccccEcccccccccEEEEEEcTTccEEEEEEEEcTccccHHHHHHHHHHHHHHHHTTccccTTTTccTcEEEcccccHHHHHHHcTTccEEETTEEEEcccc DISOP:02AL 217-218| PSIPRED ccccccccccccEEEcccccEEEHHHHcccEEEEEEEccccccccHHHHHHHHHHHHHHHHccEEEEEEEcccHHHHHHHHHHHHHHcccccEEEEEEcccHHHHHHHHHHccccccccccccccccccccEEEEEccccEEEEEEEccccccccHHHHHHHHHHHHHHHHccEEEEccccccccEEEcccccHHHHHHHcccccEEccccccccccc //