[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87273.2
DDBJ      :             Conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  35/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.66.1
:206 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  141->169 1vioA2  d.66.1.5 * 4e-04 34.5 %
:RPS:PFM   40->168 PF06353 * DUF1062 3e-31 45.7 %
:HMM:PFM   40->180 PF06353 * DUF1062 1.7e-56 51.4 140/142  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87273.2 GT:GENE AAK87273.2 GT:PRODUCT Conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(1473553..1474173) GB:FROM 1473553 GB:TO 1474173 GB:DIRECTION - GB:PRODUCT Conserved hypothetical protein GB:PROTEIN_ID AAK87273.2 GB:DB_XREF GI:159140062 LENGTH 206 SQ:AASEQ MCNLLRVQWTITPRTAPQPWLACNGCGDLRAFQASDKIRLNANGRKLDAWLIYRCLICDKSWNRPIFERQNVCDISPPVLEALQCNDPQWIRAETFNLEALRRKSQRIDEFPDFDIEKRIRDEPTDWAAAEIDLTVPFPASIRLDRLLASELGLSRSMLQKLHDGGQIRAQSDLLRRRLRNGTRIVIECGDGLDRERFWKPAVRGL GT:EXON 1|1-206:0| RP:PFM:NREP 1 RP:PFM:REP 40->168|PF06353|3e-31|45.7|129/144|DUF1062| HM:PFM:NREP 1 HM:PFM:REP 40->180|PF06353|1.7e-56|51.4|140/142|DUF1062| RP:SCP:NREP 1 RP:SCP:REP 141->169|1vioA2|4e-04|34.5|29/58|d.66.1.5| OP:NHOMO 39 OP:NHOMOORG 35 OP:PATTERN -------------------------------------------------------------------- ----2---------------------------------------------------------------1-----------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------1--------------------------------------------------------------------1----------1--111111-111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------111---1-1-111111-1221211------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED ccccEEEEEEEEEEcccHHHHHccccccccEEEEcccEEEcccccEEEEEEEEEEEcccccccccHHccccHHHccHHHHHHHHcccHHHHHHHHHcHHHHHHcccEEcccccEEEEEcccccccccccEEEEEEEEEEEcccHHHHHHHHHcccHHHHHHHHHcccEEEEHHHHHHHHccccEEEEEEcccccHHHHHHHHHccc //