[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87277.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  113/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:129 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   87->122 PF03640 * Lipoprotein_15 7e-05 50.0 %
:HMM:PFM   33->73 PF03640 * Lipoprotein_15 1.8e-20 65.9 41/48  
:HMM:PFM   84->128 PF03640 * Lipoprotein_15 3.8e-19 33.3 45/48  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87277.1 GT:GENE AAK87277.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(1476480..1476869) GB:FROM 1476480 GB:TO 1476869 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK87277.1 GB:DB_XREF GI:15156567 LENGTH 129 SQ:AASEQ MRAHHFVLAGAMALASTAALAEPYAGGAVVEKATAKGTILTDAKGMTLYTFDNDGDASSACYDGCAKKWPPLAALKTDKADGDYKPIARKDGTMQWSHDGKPLYRWQMDKKPGDITGDGVGGVWHVAKE GT:EXON 1|1-129:0| SEG 8->25|lagamalastaalaepya| RP:PFM:NREP 1 RP:PFM:REP 87->122|PF03640|7e-05|50.0|36/47|Lipoprotein_15| HM:PFM:NREP 2 HM:PFM:REP 33->73|PF03640|1.8e-20|65.9|41/48|Lipoprotein_15| HM:PFM:REP 84->128|PF03640|3.8e-19|33.3|45/48|Lipoprotein_15| OP:NHOMO 150 OP:NHOMOORG 115 OP:PATTERN ----1--------------------------------------1------------------------ ---2---------------------------------1221--1-1------112------------11--------------------------------1---1-1--------------------21--1---------------------------------1-----------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------12211--1---1-----------1-----1--11---122-11121211--------------1-------------1-------------------------------------11111222222-222122112222-22211112--2111-1111--12-1111---1------------11------------------1-----------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------3------------------------111--11111112-1111-1-1-------------------1----------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3| PSIPRED cHHHHHHHHHHHHHHHHHHHHcccccccccccccccccEEEcccccEEEEEEccccccccccccHHHHcccccccccccccccEEEEEccccccccEEcccEEEEcHHHcccccccccccccEEEEEEc //