[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87278.2
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  141/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
b.61.6
:188 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   69->147 1y0gA PDBj 5e-09 35.9 %
:RPS:SCOP  29->188 1y0gA  b.61.6.1 * 2e-33 28.3 %
:HMM:SCOP  27->190 1y0gA_ b.61.6.1 * 2.4e-33 30.1 %
:RPS:PFM   31->173 PF04264 * YceI 6e-13 32.6 %
:HMM:PFM   30->185 PF04264 * YceI 1.1e-26 30.0 150/159  
:BLT:SWISS 25->147 Y1570_ENT38 4e-13 31.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87278.2 GT:GENE AAK87278.2 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(1476980..1477546) GB:FROM 1476980 GB:TO 1477546 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK87278.2 GB:DB_XREF GI:159140064 LENGTH 188 SQ:AASEQ MKYTYSLTFLMAALACTPVSASPFSSAAGRYRIDPTSHIGFSIDQVAGPGIKGAILDISGRFDIDPDQPAKSYVEISLNPSSVKTGQERVENFLKSSAVFNIAAYPQIVFRSNRVIQDGPRSAVVEGILTARGVSRPETFHATFVEQQKGSVTFHVTGNVPRLPYGMGVGVPLYSNTVAFDIDLKGVR GT:EXON 1|1-188:0| BL:SWS:NREP 1 BL:SWS:REP 25->147|Y1570_ENT38|4e-13|31.1|122/192| BL:PDB:NREP 1 BL:PDB:REP 69->147|1y0gA|5e-09|35.9|78/169| RP:PFM:NREP 1 RP:PFM:REP 31->173|PF04264|6e-13|32.6|141/161|YceI| HM:PFM:NREP 1 HM:PFM:REP 30->185|PF04264|1.1e-26|30.0|150/159|YceI| RP:SCP:NREP 1 RP:SCP:REP 29->188|1y0gA|2e-33|28.3|159/169|b.61.6.1| HM:SCP:REP 27->190|1y0gA_|2.4e-33|30.1|163/0|b.61.6.1|1/1|YceI-like| OP:NHOMO 157 OP:NHOMOORG 142 OP:PATTERN -------------------------------------------------------------------- ---1----------------------------1---1---1--1-1---------------------322-----------------------------1-------------------------------------11------1----------------------------------------11---1--------------------------1-----1111111-1----------------------------------------------------------------------------------------------------------------------1------------------------1111-----11------12---------------11-11112111--11---3---112--------------11111111-1111-11------------------------------1-111---1--------------11--------21-1--------------------------------------21---------------1--1---211211---2--1---------------------11---1-------1-----1-----1--------------------1---11------------------------------111-1111--------------------------11-111-11111---1-----11-1--------------------1111111121------1---111111111----------------------------------1111---------------------------------------------------------1- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 133 STR:RPRED 70.7 SQ:SECSTR #############################EEEEcGGcEEEEEEEETTTEEEEEEEEEEEEEEEEcTTTGGGcEEEEEEEGGGEEcccHHHHHHHHcTTTTcTTTccEEEEEEEEEEEETTEEEEEEEEEEETTEEEEEEEEEEEEEEEEcEEEEEEEEEEET########################## DISOP:02AL 1-2| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEccccEEEEEEEEcccEEEEEEEEEEEEEEEEccccccccEEEEEEEcccEEccHHHHHHHHccHHHHHHHHccEEEEEEEEEEEccccEEEEEEEEEEccEEEEEEEEEEEEEccccEEEEEEEEEEEEHHHcccccccccccEEEEEEEEEEEc //