[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87283.1
DDBJ      :             transcriptional regulator, ArsR family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  163/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:117 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   32->92 3cuoA PDBj 1e-05 32.8 %
:RPS:PDB   17->92 1bibA PDBj 1e-10 14.9 %
:RPS:SCOP  1->106 1mzbA  a.4.5.42 * 5e-11 14.6 %
:HMM:SCOP  1->95 1u2wA1 a.4.5.5 * 7.2e-20 40.9 %
:HMM:PFM   22->75 PF01978 * TrmB 2.3e-07 27.5 51/68  
:BLT:SWISS 6->92 HLYU_VIBCH 4e-07 29.8 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87283.1 GT:GENE AAK87283.1 GT:PRODUCT transcriptional regulator, ArsR family GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(1481218..1481571) GB:FROM 1481218 GB:TO 1481571 GB:DIRECTION - GB:PRODUCT transcriptional regulator, ArsR family GB:PROTEIN_ID AAK87283.1 GB:DB_XREF GI:15156575 LENGTH 117 SQ:AASEQ MDNIGAIAALSALAQTTRLETFRRLVQHEPEGIPAGELARLIHVPQNTMSAHLATLARAGLVKSERQSRSIIYRADLEGLRALTLFLLKDCCGGATELCAPLIAELTPCCCQEAEAL GT:EXON 1|1-117:0| BL:SWS:NREP 1 BL:SWS:REP 6->92|HLYU_VIBCH|4e-07|29.8|84/108| BL:PDB:NREP 1 BL:PDB:REP 32->92|3cuoA|1e-05|32.8|61/98| RP:PDB:NREP 1 RP:PDB:REP 17->92|1bibA|1e-10|14.9|74/294| HM:PFM:NREP 1 HM:PFM:REP 22->75|PF01978|2.3e-07|27.5|51/68|TrmB| RP:SCP:NREP 1 RP:SCP:REP 1->106|1mzbA|5e-11|14.6|103/133|a.4.5.42| HM:SCP:REP 1->95|1u2wA1|7.2e-20|40.9|93/0|a.4.5.5|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 244 OP:NHOMOORG 163 OP:PATTERN -------------------------------------------------------------------- -------------------------1------------------------------------------------------------------------------------------------------------------------1-------------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1112-----1132241331331----------2-2512422121--1221111-1122121131143122221--------111---1-------------------------------1113-111121111111111-663-1111-11111221-142112-3131-11-41111111---------2-111--------1----1---------------1---------------------------11221---1------------1--1-11-21-------1--------1------------1-----12--111--1-----1-1-------------1-1-------1---1-1--1------------------------1--1-1---------------------11-1--------------1----------------1----------31-------1------------------------------------------------------------1-- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 112 STR:RPRED 95.7 SQ:SECSTR EEEEcHHHHHHHcccHHHHHHHHHHTTcccEGccHHHHHHHHTccHHHHHHHHHHHHHTTcccEEETTTEEEcccccccccHHHHHHTcccccHHHHHHHHHHHHHHHHHHc##### DISOP:02AL 1-2| PSIPRED ccHHHHHHHHHHHccHHHHHHHHHHHHcccccccHHHHHHHHcccHHHHHHHHHHHHHcccEEEEccccEEEEEEcHHHHHHHHHHHHHHHcccccHHHHHHHHccccccccccccc //