[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87286.2
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  45/68 : Bacteria  907/915 : Eukaryota  164/199 : Viruses  0/175   --->[See Alignment]
c.1.9
:260 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   2->254 1yixA PDBj 3e-46 40.6 %
:RPS:PDB   2->232 3bq6B PDBj 2e-40 11.3 %
:RPS:SCOP  3->259 1j6oA  c.1.9.12 * 9e-68 35.3 %
:HMM:SCOP  2->255 1xwyA1 c.1.9.12 * 7.7e-83 45.6 %
:RPS:PFM   3->254 PF01026 * TatD_DNase 5e-61 47.4 %
:HMM:PFM   3->255 PF01026 * TatD_DNase 3.4e-81 46.0 252/255  
:BLT:SWISS 1->254 YABD_BACSU 6e-51 38.8 %
:PROS 125->135|PS01090|TATD_2
:PROS 2->10|PS01137|TATD_1

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87286.2 GT:GENE AAK87286.2 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(1484415..1485197) GB:FROM 1484415 GB:TO 1485197 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK87286.2 GB:DB_XREF GI:159140070 LENGTH 260 SQ:AASEQ MLIDTHCHLDFPDFEAERDDIIARAHASGVSQMVTISTRVRRLPELLKIADKYPSVFCSVGTHPNNADEELDISADELVRLAESHDKIVAIGEAGLDYFYDTQKPEDQKTGLIRHIEAARRTKLPLVIHSRSADDDMAAILRAESGKGAFPFILHCFSAGPELAKAGVELGGYVSFSGILTFPKSQDIRDIAATVPLDRLLVETDAPYLAPKRWRGKRNEPSYVVNTAEVLAEVHGVSFEHMAEITTENAFRCFSKMTRV GT:EXON 1|1-260:0| BL:SWS:NREP 1 BL:SWS:REP 1->254|YABD_BACSU|6e-51|38.8|250/255| PROS 125->135|PS01090|TATD_2|PDOC00836| PROS 2->10|PS01137|TATD_1|PDOC00836| BL:PDB:NREP 1 BL:PDB:REP 2->254|1yixA|3e-46|40.6|249/265| RP:PDB:NREP 1 RP:PDB:REP 2->232|3bq6B|2e-40|11.3|222/718| RP:PFM:NREP 1 RP:PFM:REP 3->254|PF01026|5e-61|47.4|251/255|TatD_DNase| HM:PFM:NREP 1 HM:PFM:REP 3->255|PF01026|3.4e-81|46.0|252/255|TatD_DNase| GO:PFM:NREP 1 GO:PFM GO:0016888|"GO:endodeoxyribonuclease activity, producing 5'-phosphomonoesters"|PF01026|IPR001130| RP:SCP:NREP 1 RP:SCP:REP 3->259|1j6oA|9e-68|35.3|255/260|c.1.9.12| HM:SCP:REP 2->255|1xwyA1|7.7e-83|45.6|252/0|c.1.9.12|1/1|Metallo-dependent hydrolases| OP:NHOMO 1816 OP:NHOMOORG 1116 OP:PATTERN --1--11222122222211-1-1---------22111111111-----1111111111111---1111 1111111111111111111-121111111111111111111111111111111111111111111111111111111111-1111111111111221--1131111111111111111111111111111111111111111111111111111111111111111111111111111111111121111111122222222122222211111122212111111111112211111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111121111111111111111111111111112111111111111111111111111211111111111111111111111111111-11111111111121111111111111112111111111111111111111111111111111111111111111111111111111111122222222222222222222222222222222422222222222222222232222222222222111223212121211111111222222232222221111111111111111111111111111223323223333333333333333333333331-2111211111133333333333333333-33333333333333333333333322233333333333333333332333311322232223333111311111111112333233232222212222222222222232333333333333333333222232222333333333333332222222222222211311111111111111122111112-11211111111111211111111111111121 ---1442-21211-2-1112121232211111111111-1-1111111-11221-11-----111----1--1-1--------11111-2321125-111211121122372541321122333A23417L4135432-16244434334322512235222243113223246212-2E221122232142123432- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 259 STR:RPRED 99.6 SQ:SECSTR EcTTcccEEEEcccccccccccccHHHHHHHHHHTTTcccEEEEEHHHTcEETTEEcccHHHHHHHHHHHHHHHHHHHHHHHHTTcccEEEEcGGGGccccHHHcHHHHHHHHHHHHTTTHHTccEEEEccccccccHHHHHTTccccEEEEEcccccHHHHHHHHHcccTTcEEEEEEEcccccccHHHHHHHHHHTccEEEEcccGGGcccccccTTcccccTTcGGGccHHTTccHHHHHHHHTHHHHHHcccccc# PSIPRED cEEEEEccccHHHHHHHHHHHHHHHHHccccEEEEEcccHHHHHHHHHHHHHcccEEEEEEEcHHHcccccHHHHHHHHHHHHHcccEEEEEEEccccccccccHHHHHHHHHHHHHHHHHHcccEEEEEccHHHHHHHHHHHHccccccEEEEEcccccHHHHHHHHHcccEEEEccccccccHHHHHHHHHHcccccEEEccccccccccccccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccc //