[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87295.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  18/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:239 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   200->233 1dlcA PDBj 7e-04 20.6 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87295.1 GT:GENE AAK87295.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 1493163..1493882 GB:FROM 1493163 GB:TO 1493882 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK87295.1 GB:DB_XREF GI:15156589 LENGTH 239 SQ:AASEQ MHDQRPLLSSSLVRCAALIAGILLIILAALNVGIKWYGERILKAGHVTDTDEVAITIGDDRLKLAKNTLRTPLERQGGESERVDLYLTWPDLKGYEDANRAIFDDPAQAAGLIFVQLSQSTMSEDMSGRFGPIYSRLTEGEPVPLKHGLLLHRLRADSGYGKEVILTGERENDDTFVARCLLPQPPQEATGSDCQRDIHIGQDLSLFYRFSANLLPQWQKVDADVKTYIAQRLVKDGKP GT:EXON 1|1-239:0| TM:NTM 1 TM:REGION 11->33| SEG 16->30|aaliagilliilaal| RP:PDB:NREP 1 RP:PDB:REP 200->233|1dlcA|7e-04|20.6|34/584| OP:NHOMO 18 OP:NHOMOORG 18 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------111----------1----------11-11-111111111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 34 STR:RPRED 14.2 SQ:SECSTR #######################################################################################################################################################################################################HHHHHHHHHHHHHHTccHHHHHHHHHHHHHTccc###### DISOP:02AL 1-4, 187-192, 236-239| PSIPRED cccccccHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHccccccccEEEEEEcccEEEccHHHHccHHHHccccccEEEEEEEccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcHHccHHHHHHHHHcccccccccccEEEccccccccccEEEEEEEccccccEEEEEEcccccccccccccHHHHHcccccEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHcccc //