[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87299.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  40/68 : Bacteria  389/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:209 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   10->204 PF01914 * MarC 2e-28 42.8 %
:HMM:PFM   6->207 PF01914 * MarC 3.7e-57 42.3 201/203  
:BLT:SWISS 8->208 Y972_METJA 1e-22 30.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87299.1 GT:GENE AAK87299.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 1498971..1499600 GB:FROM 1498971 GB:TO 1499600 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK87299.1 GB:DB_XREF GI:15156594 LENGTH 209 SQ:AASEQ MASSETLINALTTLLVTLDPPGLAPVFLALTVGMTRDQRSQVALRGSIIAFGILAVFALFGLAILNLLGISLGAFRIAGGLLLFWISFEMIFEKRQERKEKTSEIAITKDHLHNLAVFPLALPLIAGPGAISATVLLAGSMKTTVEMVVLILILAFAMALVYAALIVSERMDRFLGNTGRAILTRLLGVLLAALSVQFVVDGIKSAFDF GT:EXON 1|1-209:0| BL:SWS:NREP 1 BL:SWS:REP 8->208|Y972_METJA|1e-22|30.0|200/228| TM:NTM 5 TM:REGION 43->65| TM:REGION 71->93| TM:REGION 115->137| TM:REGION 147->169| TM:REGION 181->203| SEG 181->194|ailtrllgvllaal| RP:PFM:NREP 1 RP:PFM:REP 10->204|PF01914|2e-28|42.8|194/203|MarC| HM:PFM:NREP 1 HM:PFM:REP 6->207|PF01914|3.7e-57|42.3|201/203|MarC| OP:NHOMO 653 OP:NHOMOORG 430 OP:PATTERN 111111-1--------1--1-2-1-----------2111111121-2212121111111112221--- 11111----------------------------------------1------1-------11-----111-------------11---1122-111--1--2221-2-11-------11-1111111---1---------------11--11---11--------11----------------11111--2--1-----------------11----------------------------------------------------------11------1111---1------------------------------------------------------------------------------1-------1---111-----211-1111-----11111111111-11-11-1-11--111111111111212111121111111--------21111-12-----------------------------111111-321-3443433333322333333233331-1-112222221111121-113-11143--------1--1---1----2-11222-1-1---12-22121-1------1111-1----------11--22322-111-2-211111111111111211211-1-2-212-11121121312222222222-2222222222222222222222221122222222222222222322122221133333333333311--11111------3-12221121----2112-------112-12232111111111-111----------12231111132322------------1-1------------------1-------------------------------------1- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 91-114| PSIPRED ccHHHHHHHHHHHHHHHHcHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHcccccccccccHHHcccHHHHccEEEcccHHHHHHcHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //