[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87302.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  21/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.43.1
:88 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   1->82 2bj3D PDBj 1e-10 18.3 %
:RPS:SCOP  1->43 2bj1A1  a.43.1.3 * 4e-06 23.3 %
:HMM:SCOP  1->48 2bj7A1 a.43.1.3 * 3.9e-08 27.1 %
:HMM:PFM   3->78 PF03693 * RHH_2 1.7e-08 28.8 73/81  
:BLT:SWISS 3->77 YV6A_VIBCH 1e-05 30.6 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87302.1 GT:GENE AAK87302.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(1501206..1501472) GB:FROM 1501206 GB:TO 1501472 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK87302.1 GB:DB_XREF GI:15156597 LENGTH 88 SQ:AASEQ MANMTFSLPDPMKDWIESRIQKGEYASASDYVRDLVRRDWARRGQDFSIDELRQIVAESRASGVGSRSMDDLFAEAERVATAHGVMRE GT:EXON 1|1-88:0| BL:SWS:NREP 1 BL:SWS:REP 3->77|YV6A_VIBCH|1e-05|30.6|72/80| RP:PDB:NREP 1 RP:PDB:REP 1->82|2bj3D|1e-10|18.3|82/130| HM:PFM:NREP 1 HM:PFM:REP 3->78|PF03693|1.7e-08|28.8|73/81|RHH_2| RP:SCP:NREP 1 RP:SCP:REP 1->43|2bj1A1|4e-06|23.3|43/50|a.43.1.3| HM:SCP:REP 1->48|2bj7A1|3.9e-08|27.1|48/0|a.43.1.3|1/1|Ribbon-helix-helix| OP:NHOMO 21 OP:NHOMOORG 21 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111------------1------------------------1--11-1111--111------------1--------------11------------------------------------1--------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11----------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 84 STR:RPRED 95.5 SQ:SECSTR cccccccccHHHHHHHHHHHHHHTcccHHHHHHHHHHHHHHHHGGGccccEEEEEEEEEEcccHHHHHHHHHHHHTTTTEEEHc#### DISOP:02AL 1-2, 86-88| PSIPRED cccccccccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHccccc //