[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87305.2
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  192/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
c.1.32
:266 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   16->191 1vpqA PDBj 2e-09 30.2 %
:RPS:PDB   158->234 1e8cA PDBj 7e-04 9.1 %
:RPS:SCOP  16->264 1vpqA  c.1.32.1 * 1e-51 24.2 %
:HMM:SCOP  5->268 1vpqA_ c.1.32.1 * 3.2e-66 40.2 %
:RPS:PFM   24->262 PF01904 * DUF72 2e-38 40.4 %
:HMM:PFM   23->265 PF01904 * DUF72 1.9e-68 41.0 222/230  
:BLT:SWISS 34->144 YECE_ECOLI 3e-08 32.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87305.2 GT:GENE AAK87305.2 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 1505366..1506166 GB:FROM 1505366 GB:TO 1506166 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK87305.2 GB:DB_XREF GI:159140081 LENGTH 266 SQ:AASEQ MSTSGTIRTGIGGWTFEPWEGTFYPEKLTKKRQLEHASRQLTAIEVNGTYYSSQKPETFAKWASEVPDDFIFSLKASRFVTNRRVLAEAGESMTKFLTQGLTELGSHLGPILWQFAPTKKFDADDFGAFLALLPEKQDGISLRHVVEVRNETFQVPEFIDLIAKYKVAVVCADHHDYPMLPDVTADFVYCRLQKGEDDIKTCYPQTGISDWAKRLKTYAAGGVPDDLPLTAPGRKVEKTQRDVFAFFITGGKINAPVGAQELQKAV GT:EXON 1|1-266:0| BL:SWS:NREP 1 BL:SWS:REP 34->144|YECE_ECOLI|3e-08|32.4|108/272| SEG 2->15|stsgtirtgiggwt| BL:PDB:NREP 1 BL:PDB:REP 16->191|1vpqA|2e-09|30.2|169/260| RP:PDB:NREP 1 RP:PDB:REP 158->234|1e8cA|7e-04|9.1|77/482| RP:PFM:NREP 1 RP:PFM:REP 24->262|PF01904|2e-38|40.4|218/229|DUF72| HM:PFM:NREP 1 HM:PFM:REP 23->265|PF01904|1.9e-68|41.0|222/230|DUF72| RP:SCP:NREP 1 RP:SCP:REP 16->264|1vpqA|1e-51|24.2|227/260|c.1.32.1| HM:SCP:REP 5->268|1vpqA_|3.2e-66|40.2|241/0|c.1.32.1|1/1|TM1631-like| OP:NHOMO 251 OP:NHOMOORG 197 OP:PATTERN ----------------1---------------------------------------------11---- 122------------11----1---1------1111111112--21-1----111-1---111-11111-------------21-1-1--------1--1-1---31211--------------------------11111---111--------11---------1112-------------2-1-----------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------1--111---1-2112-----1122231212111----------1--------1212-12232211231121-1---11111---11111111-11-------------------------------------11-----11111111----1122-------112211-------112-11-2-----1-1-----------1---11-------------222---1--2121-11-----------------------11111--------1------------------------------------------------------------------------------------------------------------------------------------1-----------------------------2122-11-111111--1------------------------1123233111---------------------------------------------------1--------12- ------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 219 STR:RPRED 82.3 SQ:SECSTR ###############ccTTcTTTccTTccGGGHHHHHTccccEEEEcccccccccHHHHHHHHTTccTTcEEEEEccHHHHHGGTHHHHTHHHHHHHHHHHHHHTTcEEEEEEEccTTccccHHHHHHHHHHHHHHHHHccccEEEEcccGGGccHHHHHHTccccEEEEETTcHHHHHHTTcTTcEEEEcccccTTTccEEEEEEEEEEccccEEEEEEETTccEEEEEcccH################################ DISOP:02AL 1-3| PSIPRED ccccccEEEEEcccccccccccccccccccHHHHHHHHHcccEEEEccHHcccccHHHHHHHHHHcccccEEEEEEEccccccccccccHHHHHHHHHHHHHHHHccccEEEEEccccccccHHHHHHHHHHHHHHHccccccEEEEEccHHHccHHHHHHHHHcccEEEEcccccccEEEEccccEEEEEEEcccccccccccHHHHHHHHHHHHHHHccccccHHHHcccccccccccccEEEEEEcccccccHHHHHHHHHHc //