[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87306.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  5/68 : Bacteria  799/915 : Eukaryota  170/199 : Viruses  0/175   --->[See Alignment]
c.1.4
:336 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   44->303 1vhnA PDBj 3e-12 25.2 %
:RPS:PDB   15->311 3c52B PDBj 1e-29 8.8 %
:RPS:SCOP  13->327 1vhnA  c.1.4.1 * 1e-56 23.2 %
:HMM:SCOP  11->327 1vhnA_ c.1.4.1 * 9.6e-74 32.1 %
:RPS:PFM   14->310 PF01207 * Dus 1e-44 38.9 %
:HMM:PFM   15->312 PF01207 * Dus 6.1e-78 33.4 287/310  
:BLT:SWISS 10->326 DUSA_SHEON e-102 54.7 %
:PROS 94->112|PS01136|UPF0034

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87306.1 GT:GENE AAK87306.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(1506173..1507183) GB:FROM 1506173 GB:TO 1507183 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK87306.1 GB:DB_XREF GI:15156601 LENGTH 336 SQ:AASEQ MYRQALASGEKIFAVAPMIDWTDTRCRFLHRQLSKRALLFTEMIVADAIIHGQREKLLGYHPQEHPVALQLGGSNPAKLAEAVRIAGDYGYDEINLNVGCPSDRVQSGTFGACLMREPEVVAQCISAMKAVAAVPVTVKCRIGVDDQEPETVLPDFLARVVAAGADAVWVHARKAWLQGLSPKENREVPPLDYDLVYRMKRDNPDVFIGINGGIADLDQAGEHLKYVDGVMLGRAAYHNTSILADVDHRIHGEEALQYDWMALRDTMMAYAADYIATGGRLNHVTRHMVGLFQGMPGARRFRQILSSDATRPGAGPEVIEAAFAAIDFNPMKELAG GT:EXON 1|1-336:0| BL:SWS:NREP 1 BL:SWS:REP 10->326|DUSA_SHEON|e-102|54.7|316/335| PROS 94->112|PS01136|UPF0034|PDOC00874| BL:PDB:NREP 1 BL:PDB:REP 44->303|1vhnA|3e-12|25.2|246/299| RP:PDB:NREP 1 RP:PDB:REP 15->311|3c52B|1e-29|8.8|284/295| RP:PFM:NREP 1 RP:PFM:REP 14->310|PF01207|1e-44|38.9|283/303|Dus| HM:PFM:NREP 1 HM:PFM:REP 15->312|PF01207|6.1e-78|33.4|287/310|Dus| GO:PFM:NREP 4 GO:PFM GO:0008033|"GO:tRNA processing"|PF01207|IPR001269| GO:PFM GO:0017150|"GO:tRNA dihydrouridine synthase activity"|PF01207|IPR001269| GO:PFM GO:0050660|"GO:FAD binding"|PF01207|IPR001269| GO:PFM GO:0055114|"GO:oxidation reduction"|PF01207|IPR001269| RP:SCP:NREP 1 RP:SCP:REP 13->327|1vhnA|1e-56|23.2|297/305|c.1.4.1| HM:SCP:REP 11->327|1vhnA_|9.6e-74|32.1|299/305|c.1.4.1|1/1|FMN-linked oxidoreductases| OP:NHOMO 1751 OP:NHOMOORG 974 OP:PATTERN -------------------------------------------------1111--------------1 111--1-11111--11111-11--111111111---11------1-111111111111--1---111111-11111111-11-1----111111111--111111211111111111111111121111111111-11111---1-221122211222212222211111122122222221222211--11122222222222222221-1122222-113122-----112111111111111111-111121-1111111133111111111111111111111111111111111111111111111111111111111111111111111111111111111111111211--111-11111111-111-2211111111212222221222222122222111-11121211212122222222222222222222212222211111111111111121111111111111111111-11111111111111112222222222111112222111112222333222332222112221212211111233333333111112112121-2112---1121121111----111111111-------1-------11-1111332333323233333333333333333333--21212--1---33332333333333333-3333333333333333333333333333333333333333333322233331-333333333333--121111122222322333333232332333322222233332333333333321223333211111111233333333223333222222222211111-1133222222222222111----1---1--------1-------111--111-1-11 2222245-412144212--111111111111111-11111111222-1111111--1-1---222212222122211-1112221223-222233211-2--155223726252134--1--3152-215C3-2231-1-3-222121--5-142462323213221333233332254Q553123343-236333334 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 328 STR:RPRED 97.6 SQ:SECSTR HHHcTcccHHHHHHcccHHHHHHHHHHHTccEEEHHHHHHHHHHTccEEEEEEHHHHHHHcHHHHHHHHHHHHHHcTTccEEEEEEEEccHHHHHHHHHHTccEEEEccTTccHHHHHHHHHHHHHHHHHHHHTTcEEEEEEcccccccccHHcHHHHHHHHHcccEEEEccccccTGGGTccccccccccccHHHHHHHHHHHcccEEEcccccccHHHHHHHHHTTcccTTcccccHHHHHHHHHHTEEEEEccccEcHHHHHHHHHHHHHHHHHcTTcccHHHHHHHHHHHHHHHHHHHHHHHTcTTcccTcccccGGGGGcTTc######## DISOP:02AL 3-7, 332-336| PSIPRED ccccccccccccEEEEccccccHHHHHHHHHHHccccEEEEcEEEccHHHcccHHHHHHcccccccEEEEEEcccHHHHHHHHHHHHHccccEEEEccccccHHHHccccccHHcccHHHHHHHHHHHHHHHcccEEEEEEccccccccHHHHHHHHHHHHHccccEEEEEcccccccccccccccccccccHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHccHHHHHHHHHcccHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHccccHHHHHHHHHHccccHHHHHHHHHHHHHHHccHHHHHHcc //