[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87332.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  16/68 : Bacteria  47/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:321 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   15->198 PF07786 * DUF1624 4e-18 33.2 %
:HMM:PFM   15->234 PF07786 * DUF1624 1.4e-78 49.8 219/223  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87332.1 GT:GENE AAK87332.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 1535030..1535995 GB:FROM 1535030 GB:TO 1535995 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK87332.1 GB:DB_XREF GI:15156632 LENGTH 321 SQ:AASEQ MDTDAAANENRRKGRIGGLDTLRGLALLAMASYHFTWNLEYFGYLEPGTATTGLWKLYARGIASSFLFLAGFSLFLAHGRGLNWQSFGKRFAMVAGAALLITVATYFAFPDSFIFFGILHNIAAASLVGLLFLRAPAPVTLLFAVIAFILPQYLQSDIFNAKWLAWIGFSTMPPRSNDYVPLLPWLAPFLGGLAVSQFVTPRGWLDRFRNPSAPRNLVASAGRHSLAFYLIHQPVLIGLVYTLSLVAPPPPVDQVELYKSSCEKSCVEQPNGAELCQRFCGCTLEKLQAENLFDTMMEGKLSADQQTKVSEVAQQCTVEAQ GT:EXON 1|1-321:0| TM:NTM 6 TM:REGION 24->46| TM:REGION 60->81| TM:REGION 93->115| TM:REGION 129->151| TM:REGION 179->201| TM:REGION 230->252| SEG 63->77|assflflagfslfla| RP:PFM:NREP 1 RP:PFM:REP 15->198|PF07786|4e-18|33.2|184/211|DUF1624| HM:PFM:NREP 1 HM:PFM:REP 15->234|PF07786|1.4e-78|49.8|219/223|DUF1624| OP:NHOMO 65 OP:NHOMOORG 64 OP:PATTERN -----------------------1----------1---11-1-11-11-1111--1---11------- ------------------------------------------------------------------------------1-----------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111--------------------------------------11111-11111-11-1111121--111111111111------1-------------------------------------------------------------------------------------------------11111-1-1--------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-11, 319-321| PSIPRED cccccccccHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHEEcccEEEEEEHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccccccHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHccHHHHcccccccccccEEEEEHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccccc //