[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87333.1
DDBJ      :             transcriptional regulator, MerR family
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  164/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.6.1
:128 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->117 1q05A PDBj 1e-08 23.1 %
:RPS:PDB   2->117 3d70A PDBj 9e-17 20.6 %
:RPS:SCOP  5->108 1jbgA  a.6.1.3 * 3e-14 27.5 %
:HMM:SCOP  2->117 1exjA1 a.6.1.3 * 1e-21 33.3 %
:HMM:PFM   48->112 PF09278 * MerR-DNA-bind 2.3e-15 32.3 62/65  
:HMM:PFM   6->39 PF00376 * MerR 1.1e-13 58.8 34/38  
:BLT:SWISS 5->128 ZNTR_ECOLI 2e-09 29.8 %
:COIL

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87333.1 GT:GENE AAK87333.1 GT:PRODUCT transcriptional regulator, MerR family GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(1536180..1536566) GB:FROM 1536180 GB:TO 1536566 GB:DIRECTION - GB:PRODUCT transcriptional regulator, MerR family GB:PROTEIN_ID AAK87333.1 GB:DB_XREF GI:15156633 LENGTH 128 SQ:AASEQ MDKYYSITELTREFGVSTRTLRFYEDEGLIHPERRGRTRLFRSADRRLIQEILRGRRIGFTIAEIREIIHVYKEPPGESGQLVLLMKKVDEKRADLRQKRKDIEETLAELDNVEEACLTRLAEIGVGT GT:EXON 1|1-128:0| BL:SWS:NREP 1 BL:SWS:REP 5->128|ZNTR_ECOLI|2e-09|29.8|114/141| COIL:NAA 36 COIL:NSEG 1 COIL:REGION 81->116| BL:PDB:NREP 1 BL:PDB:REP 6->117|1q05A|1e-08|23.1|108/122| RP:PDB:NREP 1 RP:PDB:REP 2->117|3d70A|9e-17|20.6|107/276| HM:PFM:NREP 2 HM:PFM:REP 48->112|PF09278|2.3e-15|32.3|62/65|MerR-DNA-bind| HM:PFM:REP 6->39|PF00376|1.1e-13|58.8|34/38|MerR| RP:SCP:NREP 1 RP:SCP:REP 5->108|1jbgA|3e-14|27.5|102/106|a.6.1.3| HM:SCP:REP 2->117|1exjA1|1e-21|33.3|114/118|a.6.1.3|1/1|Putative DNA-binding domain| OP:NHOMO 210 OP:NHOMOORG 165 OP:PATTERN -----------------------1-------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11--------------------------111---------1------------------------------------------------------------------------------------------------------------------------------------------------1112-11-111-----------22222222211---1--1--222-111111111211221114222222222--------1-----12------------------------------1121-11111-------1111--11111111--11111--1111-1111112---------21----------121-1-------------111---1-----------------------------------1133-11-1111-1111111211112122122---------------------------------------------------------------------------------------------------1----------11-1-------------------------1-11111111111111111-------------2-----12-11------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 127 STR:RPRED 99.2 SQ:SECSTR #cccEEHHHHHHHHTccHHHHHHHHHTTcccccEETccEEEcGGGGGHHHHHHHHHHHTccHHHHHHHTTccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc DISOP:02AL 1-2, 127-128| PSIPRED ccccccHHHHHHHHcccHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccc //