[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87340.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  13/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.110.3d.243.1
:141 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   26->130 3bz1C PDBj 3e-06 11.7 %
:RPS:SCOP  51->133 1tfoA1  d.243.1.1 * 2e-09 9.6 %
:HMM:SCOP  22->129 1g28A_ d.110.3.6 * 9.8e-11 23.1 %
:RPS:PFM   45->124 PF08447 * PAS_3 3e-08 31.6 %
:HMM:PFM   45->124 PF08447 * PAS_3 1.2e-11 31.6 79/91  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87340.1 GT:GENE AAK87340.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(1542378..1542803) GB:FROM 1542378 GB:TO 1542803 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK87340.1 GB:DB_XREF GI:15156640 LENGTH 141 SQ:AASEQ MLAFVRKKCLEVFVLGDKTDSDNALGYYMWSISDNRLIMDAVTAECHGFSQEVASRGVTIEEILERIDFEMRDQVAQAIFESITRGVFFDQRYKVHLPDGSSRWIVAKGRAIFDADNTPFLGIGSVRDITVKKAFQFEPRQ GT:EXON 1|1-141:0| RP:PDB:NREP 1 RP:PDB:REP 26->130|3bz1C|3e-06|11.7|103/447| RP:PFM:NREP 1 RP:PFM:REP 45->124|PF08447|3e-08|31.6|79/90|PAS_3| HM:PFM:NREP 1 HM:PFM:REP 45->124|PF08447|1.2e-11|31.6|79/91|PAS_3| RP:SCP:NREP 1 RP:SCP:REP 51->133|1tfoA1|2e-09|9.6|83/103|d.243.1.1| HM:SCP:REP 22->129|1g28A_|9.8e-11|23.1|104/0|d.110.3.6|1/1|PYP-like sensor domain (PAS domain)| OP:NHOMO 20 OP:NHOMOORG 13 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------1----1-------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11--------------1------------------1---1------44---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------121---------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 116 STR:RPRED 82.3 SQ:SECSTR #########################cccEEEcTTccEEEccGGGGGTTccTTTGGGccTTcccHHHHHHTccHHHHHHHHHHHTTcccTTcccccTTcccccccccHHHHHHHHHHHHHHHHHHEEHHHHHHHHHHHHHHH DISOP:02AL 138-141| PSIPRED cHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEcccEEEEcHHHHHHccccHHHHcccccHHHHHHHccccHHHHHHHHHHHHHHccccEEEEEEEEcccccEEEEEEEEEEEEcccccEEEEEEEEEEHHHHHHHHHHHHc //