[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87346.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  109/915 : Eukaryota  29/199 : Viruses  0/175   --->[See Alignment]
c.103.1
:130 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   11->129 2fi9A PDBj 2e-33 59.3 %
:RPS:PDB   13->126 3cpkA PDBj 1e-28 29.1 %
:RPS:SCOP  11->129 2fi9A1  c.103.1.1 * 2e-36 63.6 %
:HMM:SCOP  3->129 2fvtA1 c.103.1.1 * 6.4e-40 46.5 %
:RPS:PFM   18->126 PF04430 * DUF498 5e-18 43.1 %
:HMM:PFM   19->126 PF04430 * DUF498 2.9e-38 49.1 108/110  
:BLT:SWISS 8->130 YHEA_RHOCA 8e-18 39.7 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87346.1 GT:GENE AAK87346.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(1547977..1548369) GB:FROM 1547977 GB:TO 1548369 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK87346.1 GB:DB_XREF GI:15156648 LENGTH 130 SQ:AASEQ MAGGIEIRPAHFPGRAPLDAYGNGGFRFADMSHRGSLLLLPSGIYGWEPIDAKELTVEHFEKVLAEAQDIEVLLIGTGDGMRVLPKELRAAFKEAGISIDPMSTGAAVRTYNIILSESRAVAAALIAVEG GT:EXON 1|1-130:0| BL:SWS:NREP 1 BL:SWS:REP 8->130|YHEA_RHOCA|8e-18|39.7|116/124| BL:PDB:NREP 1 BL:PDB:REP 11->129|2fi9A|2e-33|59.3|118/118| RP:PDB:NREP 1 RP:PDB:REP 13->126|3cpkA|1e-28|29.1|110/115| RP:PFM:NREP 1 RP:PFM:REP 18->126|PF04430|5e-18|43.1|109/110|DUF498| HM:PFM:NREP 1 HM:PFM:REP 19->126|PF04430|2.9e-38|49.1|108/110|DUF498| RP:SCP:NREP 1 RP:SCP:REP 11->129|2fi9A1|2e-36|63.6|118/118|c.103.1.1| HM:SCP:REP 3->129|2fvtA1|6.4e-40|46.5|127/0|c.103.1.1|1/1|MTH938-like| OP:NHOMO 152 OP:NHOMOORG 138 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111111111111111111111111111-11111111111-11111111111111---1111111111-------------1-1----1111-----------------11-----1--1---1-----------1111-------1111-1--111-----1-----1--12111--------211------------------------------------------------------------------------------------------------1-1---------------------------------------------------------------------------------------------11111-------------------------------------------------------------------------------1---------------------------------------------------------------------- ------------------------------------------------------------------------------------------1----------------1--------1--11---11111635-111--1-1--1--1---1--11-----------------------12--------------1111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 119 STR:RPRED 91.5 SQ:SECSTR ##########cccccccEEEEETTEEEETTEEEcccEEEccccccEEcccccGGGccHHHHHHHHTcccccEEEEEcTccccccHHHHHHHHTTcEEEEEEEcHHHHHHHHHHHHHTTccEEEEEcccc# DISOP:02AL 1-5| PSIPRED ccccccccccccccccEEEEEcccEEEEccEEEEccEEEEcccEEcccccccccccHHHHHHHHHHcccccEEEEEcccccccccHHHHHHHHHcccEEEEEccHHHHHHHHHHHccccEEEEEEEcccc //