[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87354.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  57/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:105 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   43->104 PF11324 * DUF3126 4e-20 72.6 %
:HMM:PFM   43->104 PF11324 * DUF3126 5e-33 64.5 62/63  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87354.1 GT:GENE AAK87354.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(1557057..1557374) GB:FROM 1557057 GB:TO 1557374 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAK87354.1 GB:DB_XREF GI:15156658 LENGTH 105 SQ:AASEQ MNIALVHGKDMGDVPLSLYFRLCPMPKAAQPEPHRRIVVKADEIKKLDAYFKRTFNEKMIVKARPRKDDSAEVYLGEEFLGVVYIDDEDGDRSYNFSMAILDVDL GT:EXON 1|1-105:0| RP:PFM:NREP 1 RP:PFM:REP 43->104|PF11324|4e-20|72.6|62/63|DUF3126| HM:PFM:NREP 1 HM:PFM:REP 43->104|PF11324|5e-33|64.5|62/63|DUF3126| OP:NHOMO 57 OP:NHOMOORG 57 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1111111--1111111111111111111111-11-1-1111-11111111-1111111111------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 25-25,31-31| PSIPRED cEEEEEEcccccccEEEEEEEEccccccccccccEEEEEcHHHHHHHHHHHHHHccccEEEEcccccccEEEEEEccEEEEEEEEccccccEEEEEEEEEEEEcc //