[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87371.2
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  362/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:267 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   11->243 PF01925 * TauE 1e-12 26.8 %
:HMM:PFM   12->247 PF01925 * TauE 5.9e-42 30.3 234/239  
:BLT:SWISS 22->250 YCB9_PSEDE 9e-74 72.1 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87371.2 GT:GENE AAK87371.2 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 1574369..1575172 GB:FROM 1574369 GB:TO 1575172 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK87371.2 GB:DB_XREF GI:159140115 LENGTH 267 SQ:AASEQ MQDIALNVFIVLFCVAIFAGFIDSIAGGGGLITIPAMMIMGIAPLDTLGTNKLQAQFGSASATLAYARRGHVNLKEQLPMGLMAMAGGMLGALTAAFVPADLLRTIMPFLLITIALYFALKPQLSDIDSHRRITPFVFGLMVAPLIGFYDGVFGPGAGSFYMLAFVALAGFGMLKATAHTKLLNLGSNFGGFVVFAMGGAVLWKLGLAMGLGQFIGAQVGSRFAMKNGAKIIRPLLVVSCLAMATKLLVDASSAWSIATIWETIFPK GT:EXON 1|1-267:0| BL:SWS:NREP 1 BL:SWS:REP 22->250|YCB9_PSEDE|9e-74|72.1|229/261| TM:NTM 7 TM:REGION 15->37| TM:REGION 77->99| TM:REGION 104->126| TM:REGION 133->155| TM:REGION 159->181| TM:REGION 191->213| TM:REGION 232->254| SEG 78->96|lpmglmamaggmlgaltaa| SEG 189->201|fggfvvfamggav| RP:PFM:NREP 1 RP:PFM:REP 11->243|PF01925|1e-12|26.8|231/237|TauE| HM:PFM:NREP 1 HM:PFM:REP 12->247|PF01925|5.9e-42|30.3|234/239|TauE| GO:PFM:NREP 1 GO:PFM GO:0016021|"GO:integral to membrane"|PF01925|IPR002781| OP:NHOMO 434 OP:NHOMOORG 362 OP:PATTERN -------------------------------------------------------------------- -1---11----11------------------------111----1-11111-1111-1----11-----11--------1-1-----------------1-1------------------------------------------1-------------1------------------------111----11--222223221222332-1----222---1---------1--11111111111111111-1--------------------------------------------------------------------------1-------1-1-1-------1--------11----1---11---1----111-------1-----------11111111111-11-11-1--1--1111111--111-------1-----1-11111111----1----------------------------------1--------------------------------1111-1111111--11112-111-----11111------111-11-1---1------1-1---11-11111---11111111111-2--------1-----111---3--122222222222222222223--1----------11111121111111111-1111111111111111111111222111111111111111111111-11111-111111111111-----------------11111111111-1111111-1111111-111121111233311111--1111---211222222322221111-11----------1------------------------------------------21-121-1-1-1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,123-134| PSIPRED cccccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHccc //