[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87422.2
DDBJ      :             ABC transporter, nucleotide binding/ATPase protein
Swiss-Prot:             

Homologs  Archaea  68/68 : Bacteria  907/915 : Eukaryota  197/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:278 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   37->248 3dhwC PDBj 4e-32 35.2 %
:RPS:PDB   5->248 3dmdC PDBj 4e-39 9.5 %
:RPS:SCOP  22->260 1b0uA  c.37.1.12 * 6e-50 32.4 %
:HMM:SCOP  24->241 1ii8.1 c.37.1.12 * 2.6e-62 35.8 %
:RPS:PFM   99->187 PF00005 * ABC_tran 2e-13 45.5 %
:HMM:PFM   61->187 PF00005 * ABC_tran 1.6e-22 35.6 118/118  
:HMM:PFM   33->78 PF03193 * DUF258 6.2e-05 31.1 45/161  
:BLT:SWISS 22->275 MKL_MYCLE 1e-44 35.6 %
:PROS 159->173|PS00211|ABC_TRANSPORTER_1

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87422.2 GT:GENE AAK87422.2 GT:PRODUCT ABC transporter, nucleotide binding/ATPase protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(1629675..1630511) GB:FROM 1629675 GB:TO 1630511 GB:DIRECTION - GB:PRODUCT ABC transporter, nucleotide binding/ATPase protein GB:PROTEIN_ID AAK87422.2 GB:DB_XREF GI:159140134 LENGTH 278 SQ:AASEQ METQDQKPQETKTAKNGREAVLSVEGVTVGFNGRNVLEDLNLDVYRGEILGFIGPSGAGKSVLMRAILRLLPRQAGAIRILGTDYDKASEDDRMMLDQRLGVLFQQGALFSGLTVKENIQLPMREYLDLPKKLMDELAYLKIEMVGLKPDAGDKYPSELSGGMIKRAALARALSLDPDLVFLDEPTSGLDPIGAAEFDMLIARLRDSLGLTVYMVTHDLDSLFSVCDRIAVLGDKRVLVEGTLQDMFACDDPWVQSYFRGKRARSVVLPDGKHENPVE GT:EXON 1|1-278:0| BL:SWS:NREP 1 BL:SWS:REP 22->275|MKL_MYCLE|1e-44|35.6|253/347| PROS 159->173|PS00211|ABC_TRANSPORTER_1|PDOC00185| BL:PDB:NREP 1 BL:PDB:REP 37->248|3dhwC|4e-32|35.2|210/343| RP:PDB:NREP 1 RP:PDB:REP 5->248|3dmdC|4e-39|9.5|222/318| RP:PFM:NREP 1 RP:PFM:REP 99->187|PF00005|2e-13|45.5|88/123|ABC_tran| HM:PFM:NREP 2 HM:PFM:REP 61->187|PF00005|1.6e-22|35.6|118/118|ABC_tran| HM:PFM:REP 33->78|PF03193|6.2e-05|31.1|45/161|DUF258| GO:PFM:NREP 2 GO:PFM GO:0005524|"GO:ATP binding"|PF00005|IPR003439| GO:PFM GO:0016887|"GO:ATPase activity"|PF00005|IPR003439| RP:SCP:NREP 1 RP:SCP:REP 22->260|1b0uA|6e-50|32.4|238/258|c.37.1.12| HM:SCP:REP 24->241|1ii8.1|2.6e-62|35.8|215/370|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 52079 OP:NHOMOORG 1172 OP:PATTERN UUPCTOIIXWXUXRZNnIPRMOPY*QUprejZKEEDFDIHIGEUbUYpOU**n8TeRVaOTLJDa19A VdvQ*fairrtYcTZUXNM-Mm99W*NNNNNNyppr****X*b****izocP**xRWgCD***g*v****febbb*gebQ*guDCD9CVUTO5RGJH--FHTLMKaMZQQ8AAAAAACDDBBBBHVRLVYLKVXcTpyy**LMM*d*qq*ihoeiUVLILJOLlhco***eHLGLGHHOIKIGkbeTRynBbf*************************hq***mtyxyvuy**aqrrqronpqqqqppbhdad*ece**eRcXkvvQR**caUbmlkjkttwuzt**zytzuxtqy*swvegedcefgifedd*opjijsqtsr***********l*ly***fllh*wl*p*ktUO***nbdhpTdmetrSdcdPiYUUNJMLHJgX***cVv****************-uy*rj*t***VA**************LMM**********RQRRRRRR*chKUne*666653335545A8BC89B9A89996575MFFHGD************************t********AP**x*syov******dqlOcNVoaJKIIJIISQOepkd**VgX*pUpyfdrKgccUWclYcYZdaw*b*NNLPGNNNOKIBCCCBCCCCHTFIHQPrqzRvYhNYLzSWZaXQXgXUVWWYeYYeb5-CLXQM21-222****a*z********yy-*zz**********vwzwvy*****mpioplnoopopommpmnm*tpruuvwT4************34KIEHEEFPQSQTN*t*aaZZYWKQRNLUPVhPSTQSGTGPUre********y****q***HGFEEGFEGNgrq*ttuut*****QRSOPPOPQQFFFF77QWWVKLPOAB99A999*DbDBCBC-CCDEHHDPPLAFNBDC99AfoyWZw*vxuGgO 2233lYJ-ZJ8BUfSHDDBFLJIQCTLFFCDBEOLKCKEIFGGABCFDKNNKPNEDJ9BCCAD7B7973684BBD6836888897757-BH7DEBE8ABCB5BIDB2UejzVmUqegJFEBGUNtnBzF**s4sTvMKGAeEKxXBOHDBaDB*HXQVxIf*QqSiC*am*WjbQKIEH*IJFFLuYc*9*rPMwapmS ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-21,271-279| PSIPRED ccccccccHHHHccccccccEEEEEEEEEEEccEEEEEccEEEEccccEEEEEccccccHHHHHHHHHccccccccEEEEccEEcccccHHHHHHHHHHccEEEEcccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHccHHHccHHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHHHHHHccEEEEEEccHHHHHHHccEEEEEEccEEEEEccHHHHHccccHHHHHHHcccccccccccccccccccc //