[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87435.2
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  10/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:215 amino acids
:PSIPRED
:DISOPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87435.2 GT:GENE AAK87435.2 GT:PRODUCT hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(1648496..1649143) GB:FROM 1648496 GB:TO 1649143 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAK87435.2 GB:DB_XREF GI:159140144 LENGTH 215 SQ:AASEQ MSLRTGSALVLSLFIAAGAARADDAGLIWKPVKNSDRSYTARIGAKLPVDTPIRAGLEMGMSASKAGQVVDTPVRLWGNVTLLAEQLPGVSLARDVGVMVNALTGSSSVSMTSQQKRIVTPELDIEANRNFTVRYDGTAQQWNGLDVSQSLRLSRSETGTAFVLTGASRNSFNEFSSGVAVEQKLGDHLTVRGTLDQGYADHFRPGVSARYSIRW GT:EXON 1|1-215:0| SEG 16->26|aagaaraddag| OP:NHOMO 10 OP:NHOMOORG 10 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111-11-11111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6| PSIPRED cccccccHHHHHHHHHcccccccccccEEEcccccccEEEEEEEEEccccccccccEEEEcccccccccccccEEEEEEEEccccccccEEEEEEEEEEEEEEEccccccccccEEEEEccEEEEEEccEEEEEEccHHHHccccccHHHEEEcccccccEEEEEEccccccccccccEEEHHccccEEEEHHHccccccccccccEEEEEEEEc //