[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87443.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.28.1
:87 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   6->84 2amwA PDBj 1e-04 17.7 %
:RPS:SCOP  32->81 1dv5A  a.28.1.3 * 3e-07 32.0 %
:HMM:SCOP  7->85 1dv5A_ a.28.1.3 * 4.8e-09 30.4 %
:HMM:PFM   27->81 PF00550 * PP-binding 1.2e-06 36.5 52/67  
:BLT:SWISS 9->82 DLTC_STRS2 2e-05 31.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87443.1 GT:GENE AAK87443.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 1658132..1658395 GB:FROM 1658132 GB:TO 1658395 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAK87443.1 GB:DB_XREF GI:15156761 LENGTH 87 SQ:AASEQ MLVAKENEIDVADTIYSYLADRFPAYTPFSADTELLEGGVIDSLGFLELMVFLGESFGIILNDEHFTPDNLGTPADLITFVLRERRK GT:EXON 1|1-87:0| BL:SWS:NREP 1 BL:SWS:REP 9->82|DLTC_STRS2|2e-05|31.1|74/79| RP:PDB:NREP 1 RP:PDB:REP 6->84|2amwA|1e-04|17.7|79/83| HM:PFM:NREP 1 HM:PFM:REP 27->81|PF00550|1.2e-06|36.5|52/67|PP-binding| RP:SCP:NREP 1 RP:SCP:REP 32->81|1dv5A|3e-07|32.0|50/80|a.28.1.3| HM:SCP:REP 7->85|1dv5A_|4.8e-09|30.4|79/80|a.28.1.3|1/1|ACP-like| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 80 STR:RPRED 92.0 SQ:SECSTR #####cTHHHHHHHHHHHTTcGGGGGcccTTcccTTTcTTTTHHHHHHHHHHHHHHTTccccTTTccGGGcccHHHHHHHHHHHc## DISOP:02AL 1-7, 85-87| PSIPRED cEEEccccccHHHHHHHHHHHHcccccccccccHHHHcccHHHHHHHHHHHHHcccccEEEccccccccccccHHHHHHHHHHHccc //