[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87466.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  164/915 : Eukaryota  13/199 : Viruses  0/175   --->[See Alignment]
c.2.1
:122 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  25->93 2gyyA1  c.2.1.3 * 3e-04 25.0 %
:RPS:PFM   10->93 PF06155 * DUF971 3e-22 56.0 %
:HMM:PFM   8->92 PF06155 * DUF971 9.7e-33 51.8 85/89  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87466.1 GT:GENE AAK87466.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(1679659..1680027) GB:FROM 1679659 GB:TO 1680027 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK87466.1 GB:DB_XREF GI:15156788 LENGTH 122 SQ:AASEQ MSDAWPTELLVSKDRRELTVSFDDGSIYRLGAEMLRVLSPSAEVQGHGPGQKVTVPGKRDVTIRSMVATGNYAVRIVFDDGHDSGIYTWKYLKELGETGDALFADYERQLAEKGLNREPRFR GT:EXON 1|1-122:0| RP:PFM:NREP 1 RP:PFM:REP 10->93|PF06155|3e-22|56.0|84/86|DUF971| HM:PFM:NREP 1 HM:PFM:REP 8->92|PF06155|9.7e-33|51.8|85/89|DUF971| GO:PFM:NREP 1 GO:PFM GO:0055114|"GO:oxidation reduction"|PF06155|IPR010376| RP:SCP:NREP 1 RP:SCP:REP 25->93|2gyyA1|3e-04|25.0|68/150|c.2.1.3| OP:NHOMO 184 OP:NHOMOORG 177 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-----------11111111111-22121111111-11111111111111111------------------1---111-----------------------------------------2111111-11111111-1111211111111111111111111111111111-11111111111111---------------------------------------------------------11-----1---1-1111111111111111111--111-1--------------------------------------------------------------------------------------------1---------1-111-------------------------1111111111111111111---------1----------------------------111------------------------------------------------------1- ----11----1--------------------------------------------------------------------------------------------------1------------------------------------------------------------------11-----1-1221-11------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 113-122| PSIPRED cccccccEEEEEccccEEEEEEccccEEEccHHHHHHHccccEEEEEEccccccccccccEEEEEEcccccEEEEEEEccccccccccHHHHHHHHccHHHHHHHHHHHHHHHccccccccc //