[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87492.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  11/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:333 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   290->315 PF10691 * DUF2497 8e-05 57.7 %
:HMM:PFM   263->329 PF10691 * DUF2497 7.4e-28 47.8 67/73  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87492.1 GT:GENE AAK87492.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(1708549..1709550) GB:FROM 1708549 GB:TO 1709550 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK87492.1 GB:DB_XREF GI:15156817 LENGTH 333 SQ:AASEQ MAQPSVAREPSMEEILASIRRIIESNEPGPADAFSGQLPPVYDDEDEASGEAAFAAEPVSPPARVPPAANQAYAARPVHDFSPAFDAPLVERQESQAEKTMSLADVAARVRAAADRNAAMGPQAFAAQAQQRAAETAAPASTVSNVSQPSGVPSPERAAPQRPTDVRPLMAAVATTSAVEQPASFSAEDRAAAAAIENAPFAESRFEQLSLRGAIDTPVTAERFDVTREPAAEKSIFDLREPEAPGETDVKETAHIADGLSLNLLSAAAGAQIARSFSELAEVFDGVERRSIEDMAADMLRPMLQDWLEDNLPTLVERLVREEIERVARGSRR GT:EXON 1|1-333:0| SEG 55->69|aaepvspparvppaa| SEG 104->140|advaarvraaadrnaamgpqafaaqaqqraaetaapa| SEG 183->204|asfsaedraaaaaienapfaes| SEG 259->271|glslnllsaaaga| SEG 316->329|verlvreeiervar| RP:PFM:NREP 1 RP:PFM:REP 290->315|PF10691|8e-05|57.7|26/71|DUF2497| HM:PFM:NREP 1 HM:PFM:REP 263->329|PF10691|7.4e-28|47.8|67/73|DUF2497| OP:NHOMO 11 OP:NHOMOORG 11 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111-11111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-11, 93-97, 127-129, 132-134, 148-160, 211-247, 330-333| PSIPRED cccccccccccHHHHHHHHHHHHHccccccHHHHHccccccccccccccccHHHccccccccHHcccHHHHHHccccccccccHHccccHHHcHHHHcccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHcccHHHHHHHHHHHHHcccccccccHHHcccccHHHHccccccHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //