[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87496.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  11/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:101 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   1->22 PF08085 * Entericidin 0.00078 40.9 22/42  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87496.1 GT:GENE AAK87496.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 1712280..1712585 GB:FROM 1712280 GB:TO 1712585 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAK87496.1 GB:DB_XREF GI:15156823 LENGTH 101 SQ:AASEQ MKTLLSSAAITLSLALSGCTTAGPGTYSGPAPYVEPIPGSIIYRGQPRTKLTKSPIGSTFTHDFRIDGSTRAVETYRIAPDRSLELIDRRIIREWLFGRDD GT:EXON 1|1-101:0| SEG 3->17|tllssaaitlslals| HM:PFM:NREP 1 HM:PFM:REP 1->22|PF08085|0.00078|40.9|22/42|Entericidin| OP:NHOMO 26 OP:NHOMOORG 11 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111-33433322------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 100-101| PSIPRED ccHHHHHHHHHHHHHHHHcccccccccccccccccccccEEEEccccccccccccccccccHHEEEccccEEEEEEEEcccccEEHHHHHHHHHHHccccc //