[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87501.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  108/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.26.2
:281 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   1->281 3cisG PDBj 2e-19 14.5 %
:RPS:SCOP  3->115 1mjhA  c.26.2.4 * 6e-04 18.3 %
:RPS:SCOP  153->281 1tq8A  c.26.2.4 * 8e-13 20.3 %
:HMM:SCOP  1->146 1tq8A_ c.26.2.4 * 1.2e-09 23.2 %
:HMM:SCOP  151->281 1tq8A_ c.26.2.4 * 6.2e-16 32.3 %
:HMM:PFM   2->146 PF00582 * Usp 4.8e-06 18.8 138/140  
:HMM:PFM   155->280 PF00582 * Usp 1.1e-18 27.0 126/140  
:BLT:SWISS 140->281 Y1230_SYNY3 1e-05 29.9 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87501.1 GT:GENE AAK87501.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 1715189..1716034 GB:FROM 1715189 GB:TO 1716034 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK87501.1 GB:DB_XREF GI:15156828 LENGTH 281 SQ:AASEQ MGYKTILAVVDNVSNTQKLGEFVVSLADQFSSHVIGLHMETLAAVPLVAPMEIPDPATVQALQDVAHKETTDVGTLFERTLSTNGISHEWRSFVTSVGYASASAIDSARCADLIVARQSSSSALSDSRSDIDGFLYESGRPVLLVPHVLTVAKPIKRVLIAWNGSREATRATFDALPFLKAADSVEIFSVDQSESETQSAGLAGAELAATLARHGVNVTVTSQEKIAGLSPQAAIENRLSDNSIDLLVMGAYGHSRWWELLFGGVTRTLLDSMTAMTLLSR GT:EXON 1|1-281:0| BL:SWS:NREP 1 BL:SWS:REP 140->281|Y1230_SYNY3|1e-05|29.9|134/287| SEG 119->132|ssssalsdsrsdid| SEG 200->212|aglagaelaatla| RP:PDB:NREP 1 RP:PDB:REP 1->281|3cisG|2e-19|14.5|276/292| HM:PFM:NREP 2 HM:PFM:REP 2->146|PF00582|4.8e-06|18.8|138/140|Usp| HM:PFM:REP 155->280|PF00582|1.1e-18|27.0|126/140|Usp| RP:SCP:NREP 2 RP:SCP:REP 3->115|1mjhA|6e-04|18.3|102/143|c.26.2.4| RP:SCP:REP 153->281|1tq8A|8e-13|20.3|123/127|c.26.2.4| HM:SCP:REP 1->146|1tq8A_|1.2e-09|23.2|138/0|c.26.2.4|1/2|Adenine nucleotide alpha hydrolases-like| HM:SCP:REP 151->281|1tq8A_|6.2e-16|32.3|127/0|c.26.2.4|2/2|Adenine nucleotide alpha hydrolases-like| OP:NHOMO 251 OP:NHOMOORG 108 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------5--5-----114145334344211111111111-4H55B75B44--2111212521-423-----111111111111111111111332-------------------------------11------13--2-23211-22342222-2-12-352--111-1----11---1------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------11----------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 281 STR:RPRED 100.0 SQ:SECSTR ccTTEEEEEccccHHHHHHHHHHHHHHHHHTccEEEEEEccccccTTcccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEEcEEEEcccHHHHHHHHGGGEEEEEcccTTccTTccccHHHHHHHHHccccEEEEcTTcccccccccEEEEccccHHHHHHHHHHHHHHHHTTcEEEEEEccccccTTcccccHHHHHHHHHHHHHHHHTTHHHHcTTEcccHHHHHHHHGGGccEEEEEcccccccTTccccHHHHHHHHHccccEEEEc DISOP:02AL 121-128| PSIPRED ccccEEEEEEcccHHHHHHHHHHHHHHHHHccEEEEEEEEEccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEEccccHHHHHHHHHHcccEEEEcccccccccHHHHHHHHHHHHccccEEEEcccccccccccEEEEEEcccHHHHHHHHHHHHHHHHccEEEEEEEEccccccHHHHHHHHHHHHHHHHHcccEEEEEEEEEccccHHHHHHHHHHHccccEEEEccccccHHHHHHHHHHHHHHHHHccccEEEEc //