[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87506.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:75 amino acids
:PSIPRED
:DISOPRED
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87506.1 GT:GENE AAK87506.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 1723735..1723962 GB:FROM 1723735 GB:TO 1723962 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAK87506.1 GB:DB_XREF GI:15156835 LENGTH 75 SQ:AASEQ MRHGHKFSLANHPSRWPRYIMAHRRPRDWLMTISGIVLLFIVAAAVAMGYLVTSHPGKPEPNSGIVEEQAAENRG GT:EXON 1|1-75:0| TM:NTM 1 TM:REGION 31->53| SEG 42->47|vaaava| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5, 7-8, 59-75| PSIPRED cccccccccccccccHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHccccc //