[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87514.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  54/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:326 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   150->198 3d30A PDBj 9e-04 38.3 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87514.1 GT:GENE AAK87514.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 1731394..1732374 GB:FROM 1731394 GB:TO 1732374 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK87514.1 GB:DB_XREF GI:15156845 LENGTH 326 SQ:AASEQ MSAIKIAARLAIAFAAIGVLSQAAFSQDAFKDFKQLGGTPKMPKLNAFTAPSAPNAPTSTARDIAMEAKLTSEGEAVKEGLSWRVFSPIPGTDGKLPMLASSEGGSAQFHLVPGEYFVNVAFGRAGVTKKLNVPASGNVQKQVLILDAGGFVLNAIAGSDKQISGNQLKFSVYSSDARPDGERGLVMADIKPNTIVRLNAGTYHVVSEYGNVNAVVRADIQVEAGKLTEATLQHQAAQITLKLVSEQGGEAIADTAWSVLNGGGDVVNESVSAFSTMVLAEGEYTAIARNKDKVYQRNFKVTSGRDSDVEVLMKDQAPEDMTGDFE GT:EXON 1|1-326:0| TM:NTM 1 TM:REGION 3->25| SEG 3->17|aikiaarlaiafaai| SEG 46->61|naftapsapnaptsta| BL:PDB:NREP 1 BL:PDB:REP 150->198|3d30A|9e-04|38.3|47/208| OP:NHOMO 54 OP:NHOMOORG 54 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111111111111111111111111-1111111111-111111111111111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 47 STR:RPRED 14.4 SQ:SECSTR #####################################################################################################################################################GGcTTTTTTcEEEEEETTEEEEEEEEEEcTTccTTcE##EEcHHHHHHH################################################################################################################################ DISOP:02AL 1-2, 30-63, 320-326| PSIPRED cHHHHHHHHHHHHHHHHHHHHccHHHHHHcccccccccccccccccccccccccccccccccEEEEEEEEcccccccccccEEEEEEccccccccccEEEEEcccccccccccccEEEEEEEEEccEEEEEEEEcccccEEEEEEEcccEEEEEEEcccccEEcHHHEEEEEEcccccccccccEEEEccccccEEEEccccEEEEEEEccccEEEEcccEEEcccEEEEEEEEEEEEEEEEEEEcccccEEEEcEEEEEcccccEEEEEccccEEEEEccccEEEEEEEccEEEEEccEEEcccccEEEEEEcccccccHHcccc //