[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87523.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  89/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
f.51.1
:245 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   65->215 2irvA PDBj 2e-09 33.6 %
:RPS:SCOP  57->168 2ic8A1  f.51.1.1 * 4e-14 29.4 %
:HMM:SCOP  24->245 2nr9A1 f.51.1.1 * 3.2e-24 27.0 %
:RPS:PFM   82->159 PF01694 * Rhomboid 1e-08 39.7 %
:HMM:PFM   81->242 PF01694 * Rhomboid 4.5e-24 34.1 135/146  
:BLT:SWISS 70->213 GLPG_YERPY 3e-11 31.7 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87523.1 GT:GENE AAK87523.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(1739212..1739949) GB:FROM 1739212 GB:TO 1739949 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK87523.1 GB:DB_XREF GI:15156854 LENGTH 245 SQ:AASEQ MSYEDGEQPPVSETPEPKDDTNNPIFNLPGLLVGILAALAIAYVVPAYLLSEEGNGWFIFTFGFIPLRYAVPFSQQGLEWLWTPVTYSFLHGGIEHILFNGLWLMAFGAPVLRRIGTVRFVLLWCISAAVSAFGHAALNWGDVTVLIGASGVVSALMGAACRFAFPVRGGYSASFGHLMPRQSILAALSNRTVLIFTLMWLFGNVLIAIGVPLFGDVGGQIAWDAHVFGFLLGFLFFSLFDRPSR GT:EXON 1|1-245:0| BL:SWS:NREP 1 BL:SWS:REP 70->213|GLPG_YERPY|3e-11|31.7|126/278| TM:NTM 7 TM:REGION 27->49| TM:REGION 61->83| TM:REGION 91->112| TM:REGION 116->138| TM:REGION 142->164| TM:REGION 192->214| TM:REGION 220->242| SEG 28->50|lpgllvgilaalaiayvvpayll| SEG 228->240|fgfllgflffslf| BL:PDB:NREP 1 BL:PDB:REP 65->215|2irvA|2e-09|33.6|131/176| RP:PFM:NREP 1 RP:PFM:REP 82->159|PF01694|1e-08|39.7|78/146|Rhomboid| HM:PFM:NREP 1 HM:PFM:REP 81->242|PF01694|4.5e-24|34.1|135/146|Rhomboid| GO:PFM:NREP 2 GO:PFM GO:0004252|"GO:serine-type endopeptidase activity"|PF01694|IPR002610| GO:PFM GO:0016021|"GO:integral to membrane"|PF01694|IPR002610| RP:SCP:NREP 1 RP:SCP:REP 57->168|2ic8A1|4e-14|29.4|109/182|f.51.1.1| HM:SCP:REP 24->245|2nr9A1|3.2e-24|27.0|185/0|f.51.1.1|1/1|Rhomboid-like| OP:NHOMO 90 OP:NHOMOORG 89 OP:PATTERN -------------------------------------------------------------------- --1---------1-------------------------------------------------------1----------------------------------------------------------------------11------------------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--1----------11-1111111111-1111--111111111111-11111111112-111111111111111---------------------------1-----------------------------------------------------------------------------------------------------------11------1--1--------------------------------------------------1--------------------------------------------------------------------------------------------------------------11111111111----------------------------------------------------------------------------11111-1-11---------------------------------------------------------------1--1------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 137 STR:RPRED 55.9 SQ:SECSTR ################################################################HHHHHcccccGGGTTcTTHHHHGGGccccHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHcHHcccccccHHHHHHHHH###########HHHHHHHHHcGGGcccc###cTTHHHHHHHHHHHHcccccTHHHHH############################## DISOP:02AL 1-24| PSIPRED ccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHcccc //