[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87524.2
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  48/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:198 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   22->147 PF07310 * PAS_5 6e-20 44.0 %
:HMM:PFM   14->150 PF07310 * PAS_5 1.9e-53 50.7 136/137  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87524.2 GT:GENE AAK87524.2 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 1740266..1740862 GB:FROM 1740266 GB:TO 1740862 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK87524.2 GB:DB_XREF GI:159140180 LENGTH 198 SQ:AASEQ MDMMSQKRTRRNAMKSMAGLDIYAYWDELRGSRSAPRREDINPAKLKTHLGDLFILTDKGEATPFFRLAGTRLCDLFGRELRDRPFSELWQPVNATFPCRVARGILHHQLPVIFDVEAEDEYGAAPLAFEMLLLPLRTDADAAPRLLGALLAERPRHEFAAPISCLSMKSSRLLRMDIAPSEHRADMETASTPFAGSF GT:EXON 1|1-198:0| RP:PFM:NREP 1 RP:PFM:REP 22->147|PF07310|6e-20|44.0|125/135|PAS_5| HM:PFM:NREP 1 HM:PFM:REP 14->150|PF07310|1.9e-53|50.7|136/137|PAS_5| OP:NHOMO 48 OP:NHOMOORG 48 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1111111111111111111111-11-1111-11--111-11111111----1111----1-1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-18| PSIPRED cccHHHccccccccccHHHHHHHHHHHHHHcccccccHHHccHHHHHHHcccEEEEEEccccEEEEEEcHHHHHHHHccHHccccccccccHHHHHHHHHHHHHHHcccEEEEEEEEccccccccccEEEEEEEccccccccccEEEEEEccccccEEccccHHHccEEEEEEccccHHHHHcccccccccccccccc //