[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87527.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  83/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:144 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   5->144 PF07370 * DUF1489 2e-40 62.5 %
:HMM:PFM   5->144 PF07370 * DUF1489 5.7e-60 59.6 136/137  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87527.1 GT:GENE AAK87527.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(1743249..1743683) GB:FROM 1743249 GB:TO 1743683 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK87527.1 GB:DB_XREF GI:15156859 LENGTH 144 SQ:AASEQ MPLHLIKLCVGADSLQDLREWVAHRSLTAIAAGLEPHSVHTTRMIPKRVEELLEGGSLYWVIKGQVQARQNLLDIRSFKGDDGITRCDLILGPEVIETSPAPKRPFQGWRYLKDDEAPRDLGGGGGGEDMPSDLRRELAELGLL GT:EXON 1|1-144:0| SEG 122->127|gggggg| RP:PFM:NREP 1 RP:PFM:REP 5->144|PF07370|2e-40|62.5|136/137|DUF1489| HM:PFM:NREP 1 HM:PFM:REP 5->144|PF07370|5.7e-60|59.6|136/137|DUF1489| OP:NHOMO 83 OP:NHOMOORG 83 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111-------1111111111111111111111-11111111111-1111111111111111111111111111111111111111-11------------------------------1111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 123-127| PSIPRED cccEEEEEEEccccHHHHHHHHHHHHHHHHHccccccEEEEcccccccHHHHHcccHHHHHHHHHHHHHHHHcccEEEEcccccEEEEEEEccEEEEcccccccccccccccccccccccccccccHHcccHHHHHHHHHHccc //